Identifiers and Description

Gene Model Identifier

SteCoe_14266

Standard Name

None

Aliases

None

Description

UQ_con domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000067081.9792598779469045e-32
Saccharomyces CerevisiaeYDR092W1.462486227251231e-31E2 ubiquitin-conjugating enzym
e; involved in the error-free
DNA postreplication repair pat
hway; interacts with Mms2p to
assemble ubiquitin chains at t
he Ub Lys-63 residue; DNA dama
ge triggers redistribution fro
m the cytoplasm to the nucleus
Oxytricha TrifallaxContig14276.0.g392.9374821117108028e-30Ubiquitin-conjugating enzyme

Tetrahymena ThermophilaTTHERM_011239502.1705220113036395e-29E2 ubiquitin-conjugating enzym
e family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14266(Protein)
MANLSRRIQKETERLSMDAVPGISAAPDPNNSRYFHIQISGPQSTPYESGIFALELFLPD
DYPMCPPKVRFLTKIYHPNVDRLGRICLDILKDKWSPALQIRSVLLSIQALMSAPNPDDP
LDPAIARHWKEDESGANRTAREWCLTYACH


>SteCoe_14266(CDS)
ATGGCAAATCTCAGCAGGAGAATCCAAAAAGAAACAGAAAGACTGAGTATGGACGCTGTA
CCAGGGATCTCAGCTGCTCCCGACCCTAATAACTCTCGTTATTTCCACATACAGATTTCA
GGACCCCAGTCAACTCCTTATGAAAGTGGAATTTTTGCGCTCGAGTTATTTTTACCAGAT
GATTACCCTATGTGCCCTCCAAAGGTAAGATTTTTAACTAAAATTTACCATCCAAATGTT
GACAGACTCGGGAGGATTTGCCTTGACATTTTAAAGGACAAATGGTCTCCGGCGCTTCAA
ATAAGATCTGTTCTTTTGAGTATTCAAGCACTTATGAGCGCTCCTAACCCTGACGACCCT
CTTGACCCAGCTATAGCTAGACATTGGAAAGAAGATGAAAGTGGTGCAAATAGAACTGCA
AGAGAATGGTGCCTTACTTATGCTTGCCATTAA