Identifiers and Description

Gene Model Identifier

SteCoe_14285

Standard Name

None

Aliases

None

Description

CNOT1_HEAT domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig709.1.g911.0112214926104486e-43AAA domain

Tetrahymena ThermophilaTTHERM_000955009.854154686111257e-34CCR4-Not complex component, No
t1 family protein
WormBaseWBGene000028451.462486227251231e-31
Saccharomyces CerevisiaeYCR093W5.242885663363464e-22Component of the CCR4-NOT1 cor
e complex; this complex has mu
ltiple roles in regulating mRN
A levels including regulation
of transcription and destabili
zing mRNAs by deadenylation; b
asal transcription factor

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14285(Protein)
MTSLESCVCQHIKNLVGSLTNKKQFKPVSSELQKLVSTFGVAAEKFLFSVLLQEIDFKDP
RTASGSKDQFKLQFLTQIIQIYSIKPSFLDYFSQIFPSGDIEEFLESFVKILNLTTLTQI
VLSVSLSLSSTPHVARAGLLILKSKLQLYISQNKPQRIPSFALHCILYLLKTSNEFSETS
CKDWSNFLISNNMLDDKSKFLPLLGETKESFNLGDSKTMIIGEIKNSLTLAEILEDMGPH
CSQSQSTLREVLSNFPDIRESEMAEVLAVLCEKCTDMLDYESRVISATFSSVKQEDWQAL
GREISDKRTQTTWNLDNFSKVIRETYTLHWDLVIENLDIPRFVIKNEQAFSLLVNFFYKI
TGKKFPILPLFKIWKNPRGQVSLLLQAIYSPLPYEIFNFADSPNKAPTEEIDMQPELKGI
IQALSSLDLLKVMFELSATEFYTSIRNVFINEIKRFPDILIIGFSIVKPTRGQNLLNELI
NIIMPQFMSPQTSNPLVLQIIWNQNPELIIHGAVEYYEKDPTSIALTQLLDLTQEIRDSL
LKLVNCDNHYFTVHFGLLAIKRDFLHLEHWIKERISQGKEPFVRALLDYLEKNIIDFIKD
TKDQRIIEAVFDKAQVTKESIVVIIEKLMEGNFSTDLQGKVQEFYKIILSQYPALLPPPS
SQEEIDDAANKYYQQLYSNEISIAEFLSLVKRLKSSAIKHENEIFDCMINNLFDEFRFFN
KYPEKELKITGELFGALIYQNLLVGVHLFLALKHIEMALRTPKSKLFRFGWFALSQFKDR
LVEWPNFCNELSASNGLKEEHPEFIEWLNNYFNMKKTEESKESPLPTPKAEPIANWDKKP
EEESKFLISDNTKDRIMFIINTTDSQNVLEKSEELKKILTENELANIPWFANYLVSKRVS
LEINFHELYLKVIKSIGMKSIYSAIILETYTSIHKLLNLSKPLDDNERKILNSLGLWIGT
LTIARNKPILIRFIDLKSEIIKSYEKENMNTVIPFICNILKSCISSDVFTQANPWMISMF
SLLYELKQKPELKLRIAHEIDSLFKAIKVSPETFPQTNLLNAREVKPFENVKDFTPVPEV
VVLTSENRSMASLPEYVHISPKLADLYPEQELKKIISISIEQVIKEIIQPIVQRNVNIAL
ITTKELVLKDFALEKDAQKLQEASHWVVQSLAGSLARVTSREPFRVHLVNSLNEVFKNKG
LSPEVCKQIVENASLDNLELGCGLIAKIVIEKALGDVNHEEHIKEAYNKRLQNSDSKYFE
DVSHTKATPLHMLPEILRPKQTGLSKEQFQVYKDFITIIDNPKKSSSAPPQEIKNPDHPM
FKFEKLIEVAETIISSRSEAEDPEVQHAINNVIEIAFSGKQDFILNCTSAVFKRMYNNEL
LISFYILILQNMKNTQPSLAKDITEWMIKIEDHKKFYWPVASEVIRADILILSDFDKMIS
KAVEIDNTLAVSFAHQLIQEFIIKSNLFPVSSFANTILSLKSLKDRQPKNEELNKLLQDI
PEVKISLSFSSENDKQKEMIIQKFEDWLNMTTGEPFINSDKAPLFVNTLESLGMHNKDKM
EGLFSVMIEYAIERNKYAEDGSYRIIDSFAKLFHVVMLMAQPPNKMKPLLCVLMALKNLI
LKASAVNFNSRPYFRIFMLILTDVTQPSPAITDQGLVQDMLIPIASTLHMLNPTRVPSFC
FSWLDLISHRYFLPRMLRTVNPSSDRSQVPLQWTKMSILLIDLFKFVYNHFSTFPLNDSL
RAFYNGVVKVVFVIMHDFPEFLCDYHFDFCNYIPEHCLQLKNLVLSAYPRAMRPPSPFIP
NLKVDLLPEMKIAPNILSNYKGKLGGMKDDVDNYFASRDSSYIQEINNKLKSTENRANGT
LANCLVLYIAEIALAGQIDQRVYNEFLLAILNGLDNETRKHYINAVANQLRYPNSHTQMF
SCALLYMFSECKKPIIEEQIARVLTERTSAYRPHPWGVLITLIELVKNPRYEFLKKPFTH
CTQDIENYYEKISKNFMADSDVLHNN


>SteCoe_14285(CDS)
ATGACAAGTCTGGAGAGCTGCGTATGTCAGCACATCAAAAACCTTGTTGGCAGCTTGACA
AACAAAAAACAATTCAAACCTGTTTCCTCAGAACTCCAGAAACTCGTGTCAACATTTGGT
GTGGCTGCAGAAAAGTTCCTATTCAGCGTCCTTTTACAAGAAATAGATTTCAAAGACCCA
CGAACAGCTTCAGGATCCAAAGACCAGTTCAAACTCCAGTTCTTAACCCAAATCATTCAA
ATTTATTCAATAAAACCATCATTTCTTGATTATTTTAGCCAAATCTTCCCTTCTGGAGAC
ATTGAAGAATTTCTTGAAAGTTTTGTCAAAATCCTCAACCTTACAACCTTAACACAAATA
GTCCTTTCAGTAAGCCTTTCTTTATCAAGTACCCCTCATGTTGCTAGAGCTGGTTTACTT
ATCCTAAAATCCAAACTTCAATTATACATTTCTCAAAACAAACCTCAAAGAATTCCATCA
TTTGCCCTTCATTGTATATTGTATTTACTTAAAACTTCTAATGAATTCTCAGAAACATCT
TGTAAAGATTGGTCTAATTTCCTTATTTCTAATAACATGCTTGATGATAAATCAAAATTT
CTCCCTTTATTAGGAGAAACTAAAGAGAGTTTTAACCTTGGGGATTCTAAAACTATGATT
ATAGGGGAAATTAAAAACTCATTAACTTTAGCGGAAATATTAGAAGATATGGGACCACAT
TGTTCTCAGTCTCAAAGCACATTAAGAGAAGTATTATCTAATTTCCCTGATATAAGAGAG
AGTGAAATGGCTGAAGTCTTAGCGGTATTATGTGAAAAATGTACAGATATGTTAGATTAT
GAATCTAGGGTTATATCAGCAACATTTTCTTCAGTTAAACAAGAAGATTGGCAGGCTTTA
GGAAGAGAAATTAGTGATAAAAGGACTCAGACAACTTGGAATTTAGACAATTTTTCTAAA
GTGATAAGAGAAACTTATACTTTACACTGGGATTTGGTTATTGAAAATTTGGATATCCCA
AGATTTGTTATTAAAAATGAACAAGCGTTTTCTTTACTTGTCAACTTTTTCTATAAAATT
ACTGGGAAAAAATTCCCTATTTTGCCGCTTTTTAAGATATGGAAAAATCCTAGAGGACAA
GTATCGCTGTTATTGCAGGCTATTTATAGTCCACTGCCTTATGAGATTTTTAATTTTGCT
GATAGTCCTAATAAAGCTCCAACAGAAGAGATAGATATGCAACCTGAACTTAAAGGAATC
ATACAAGCTTTATCATCATTGGATTTACTTAAAGTTATGTTTGAATTAAGTGCTACAGAG
TTTTATACAAGCATTCGAAATGTATTTATAAATGAAATCAAACGTTTTCCAGACATTTTA
ATAATCGGGTTTTCTATAGTAAAACCAACTCGTGGTCAAAATTTACTTAATGAACTTATA
AATATTATAATGCCTCAATTCATGTCCCCACAAACATCTAATCCTCTTGTCCTTCAAATA
ATCTGGAATCAAAACCCAGAACTTATAATTCATGGTGCTGTTGAGTATTATGAAAAAGAT
CCTACATCTATAGCATTAACCCAATTATTAGACTTAACTCAAGAAATCCGTGACTCTCTT
TTAAAACTCGTCAATTGCGACAATCATTATTTTACTGTTCATTTCGGACTTTTAGCTATA
AAAAGAGACTTTCTTCATTTAGAACATTGGATAAAAGAACGTATTTCTCAAGGTAAAGAA
CCTTTTGTTAGAGCACTTTTAGATTATTTAGAAAAAAACATCATAGATTTTATTAAAGAT
ACTAAAGACCAAAGGATAATAGAAGCTGTTTTTGATAAAGCCCAAGTGACAAAAGAAAGC
ATAGTTGTTATTATAGAAAAACTTATGGAAGGGAATTTTTCTACAGATCTTCAAGGTAAA
GTTCAAGAGTTTTATAAGATTATTTTATCTCAATACCCAGCTTTGTTACCTCCTCCAAGT
TCTCAAGAAGAGATTGATGATGCGGCAAATAAATATTATCAACAACTTTATTCAAATGAA
ATTTCTATAGCTGAGTTTTTGAGTTTGGTTAAAAGGTTAAAATCTTCAGCTATAAAACAT
GAAAATGAAATTTTTGATTGTATGATTAATAATTTGTTTGATGAATTTAGGTTTTTTAAT
AAGTATCCGGAAAAGGAACTTAAGATTACTGGGGAACTTTTTGGTGCTTTGATATATCAG
AATTTACTTGTTGGAGTGCATTTGTTTTTAGCTTTGAAACATATTGAGATGGCTTTGAGA
ACACCAAAGTCAAAATTGTTTAGGTTTGGGTGGTTTGCTTTGAGTCAGTTTAAGGACAGA
CTTGTTGAGTGGCCGAATTTCTGTAATGAACTTTCTGCTTCTAATGGACTTAAAGAAGAG
CATCCAGAGTTCATCGAATGGCTTAATAACTACTTCAACATGAAAAAAACTGAAGAATCC
AAAGAATCACCTCTCCCAACACCAAAAGCCGAGCCTATAGCTAACTGGGATAAGAAACCC
GAAGAAGAAAGCAAGTTCTTAATCTCAGACAACACAAAAGATCGAATAATGTTTATAATA
AACACAACCGATTCTCAAAATGTATTAGAAAAATCTGAAGAGCTAAAAAAAATCTTAACA
GAAAATGAATTGGCAAATATCCCATGGTTCGCAAATTACCTAGTCTCTAAACGTGTATCC
CTAGAAATCAACTTCCATGAACTTTACCTAAAAGTTATAAAAAGTATCGGAATGAAAAGT
ATTTATTCAGCTATTATCTTAGAAACCTATACATCAATACATAAACTATTAAATTTATCT
AAACCATTAGATGATAATGAACGTAAAATCCTAAATTCACTTGGTTTATGGATTGGAACT
TTGACTATTGCTAGAAACAAGCCGATTTTGATTAGATTTATAGACTTAAAAAGTGAAATT
ATAAAATCTTATGAAAAAGAAAATATGAATACAGTTATACCATTTATATGTAATATATTA
AAAAGTTGTATTAGTTCTGATGTTTTTACTCAGGCTAATCCATGGATGATTTCTATGTTT
TCATTATTGTATGAGTTAAAACAGAAACCTGAATTGAAACTTCGTATTGCTCATGAGATT
GATAGTTTATTTAAAGCTATTAAGGTATCACCAGAAACTTTCCCACAGACTAATTTGTTG
AATGCTAGAGAAGTTAAGCCTTTTGAGAATGTTAAGGATTTTACACCTGTACCAGAAGTG
GTTGTACTTACAAGTGAAAATAGGTCTATGGCTTCATTACCTGAATATGTGCATATTTCC
CCGAAACTTGCTGATTTATACCCAGAACAAGAACTGAAAAAAATCATATCAATCTCAATC
GAACAAGTAATCAAAGAAATAATCCAACCAATAGTCCAAAGAAATGTAAACATCGCCTTA
ATAACCACAAAAGAATTAGTTCTTAAAGATTTCGCTTTAGAAAAAGATGCACAAAAACTT
CAAGAAGCTTCTCATTGGGTAGTCCAAAGCTTAGCAGGAAGTTTAGCCCGTGTGACATCA
AGAGAACCTTTTCGTGTTCATCTTGTGAATTCTCTAAATGAAGTTTTTAAAAATAAAGGA
CTTTCTCCTGAAGTTTGTAAGCAAATAGTTGAAAATGCATCTTTAGATAATCTTGAACTT
GGATGTGGACTTATAGCTAAAATTGTTATTGAAAAAGCTCTTGGAGATGTAAATCATGAA
GAACATATTAAAGAAGCTTATAATAAAAGACTTCAAAATTCAGATTCTAAATACTTTGAA
GATGTTAGCCATACAAAAGCTACACCTTTACATATGCTCCCAGAAATACTTAGACCAAAA
CAGACTGGGTTGTCTAAAGAGCAATTTCAAGTTTATAAAGATTTTATAACAATTATTGAT
AATCCTAAAAAATCATCTTCAGCTCCACCTCAGGAAATTAAAAACCCTGACCACCCTATG
TTTAAGTTTGAGAAACTGATTGAAGTTGCTGAGACTATTATTTCTTCAAGAAGTGAAGCA
GAAGACCCTGAAGTACAACATGCTATTAATAATGTTATTGAAATAGCATTCAGTGGAAAA
CAAGACTTTATCCTAAACTGCACATCAGCTGTTTTCAAGCGCATGTACAACAACGAACTA
TTAATTTCCTTCTACATCCTAATCCTCCAGAACATGAAAAACACTCAGCCATCTTTAGCC
AAAGACATAACCGAATGGATGATCAAAATCGAAGACCATAAAAAATTCTACTGGCCTGTA
GCAAGTGAAGTAATCCGTGCCGACATCTTAATCCTTTCTGATTTCGACAAAATGATAAGC
AAAGCAGTAGAAATCGATAACACCTTAGCTGTATCATTTGCTCATCAACTAATTCAAGAA
TTCATAATAAAATCCAATCTTTTCCCAGTCTCATCATTTGCCAACACAATCCTCTCTTTA
AAATCCTTAAAAGATCGCCAGCCTAAAAATGAAGAACTTAATAAACTCCTTCAAGATATA
CCCGAAGTAAAAATCTCCCTATCATTTTCTTCAGAAAATGATAAACAAAAAGAAATGATC
ATACAAAAATTTGAAGATTGGCTTAATATGACAACTGGTGAACCTTTTATCAATAGCGAT
AAAGCTCCATTATTTGTCAATACTTTAGAAAGTTTAGGAATGCATAACAAAGATAAAATG
GAAGGTTTGTTTTCAGTTATGATTGAATATGCAATAGAAAGAAATAAATATGCAGAAGAT
GGTAGTTATAGGATAATAGACAGTTTTGCTAAACTGTTTCATGTAGTGATGCTTATGGCT
CAACCACCTAATAAAATGAAACCTTTATTATGTGTACTTATGGCTTTAAAGAACCTTATA
TTAAAAGCATCAGCAGTTAATTTCAACTCAAGACCTTATTTTAGGATTTTTATGTTAATA
TTAACTGATGTAACTCAACCATCACCAGCTATTACAGATCAAGGTTTGGTTCAAGATATG
CTTATCCCTATAGCTAGTACTTTACATATGCTTAACCCAACCCGTGTACCATCTTTTTGC
TTTAGTTGGCTTGATTTGATTTCTCATAGATACTTCCTCCCTAGAATGCTCAGAACAGTC
AACCCATCTTCAGATCGAAGCCAAGTCCCTCTTCAATGGACTAAAATGAGCATTTTACTT
ATTGACTTATTCAAATTTGTCTATAACCATTTCAGCACTTTCCCTCTTAATGACTCTTTA
AGAGCATTTTATAATGGTGTTGTCAAAGTTGTATTTGTTATCATGCACGATTTCCCTGAG
TTCCTTTGTGATTATCACTTTGATTTCTGCAACTACATTCCTGAACATTGCCTTCAGTTA
AAAAACCTTGTCTTAAGTGCATACCCAAGAGCTATGAGACCACCTTCACCATTTATCCCT
AATCTTAAAGTTGACCTACTTCCTGAAATGAAAATTGCCCCAAATATCTTATCTAATTAC
AAAGGGAAACTTGGGGGGATGAAAGATGATGTTGATAATTATTTTGCTAGTAGGGATTCT
AGTTATATACAAGAAATAAACAATAAATTGAAATCAACTGAAAATAGGGCTAATGGAACT
TTAGCTAATTGTTTAGTATTATATATTGCTGAGATTGCATTAGCTGGACAAATAGATCAA
AGGGTTTATAATGAGTTTTTATTAGCAATTTTGAATGGATTGGATAATGAGACTAGAAAA
CATTATATAAATGCTGTAGCTAATCAGCTTAGGTACCCGAATTCTCATACACAAATGTTT
TCGTGTGCTTTGCTGTATATGTTTAGTGAGTGTAAGAAACCGATTATTGAAGAACAGATT
GCTAGGGTTTTAACTGAAAGGACTAGTGCTTATAGGCCGCATCCGTGGGGGGTGTTGATA
ACGCTGATTGAACTAGTGAAGAACCCGAGGTATGAGTTTTTGAAGAAACCATTTACCCAT
TGCACTCAGGATATTGAGAATTATTATGAGAAAATCAGCAAGAACTTCATGGCAGATTCG
GATGTTTTGCATAATAACTAG