Identifiers and Description

Gene Model Identifier

SteCoe_14429

Standard Name

None

Aliases

None

Description

B3_4 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000014980
Tetrahymena ThermophilaTTHERM_002184101.3485799642996046e-77phenylalanyl-tRNA synthetase,
beta subunit family protein
Saccharomyces CerevisiaeYLR060W2.7086952666810816e-76Beta subunit of cytoplasmic ph
enylalanyl-tRNA synthetase; fo
rms a tetramer with Frs2p to g
enerate active enzyme; able to
hydrolyze mis-aminoacylated t
RNA-Phe, which could contribut
e to translational quality con
trol
Oxytricha TrifallaxContig14504.0.g564.020060215743355e-74B3/4 domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14429(Protein)
MPKVTVAKCELYNELAIDMTEDEFRDLCFEFGLELDDVTVEKTASGKEEVFFKIEVAANR
YDLLCIEGLTQALRVFMGKQRMPEYQLATPAEPLTMTVEVATSQIRPYVVCAVLRNLHFT
ENSYNSFIELQEKLHQNICRKRTLVAIGTHDLDTLSGPFLYTAKPPNDIKFRALNQSEEH
TATELMSIYSADVRMKKYVPIILDSPVYPVIYDSKGVVLSMPPIINGEHSKITLSTKNVL
IECTATDKHKAQIVLNTIIAAFSKYCENPFSTEIVKVVYSDHEETTPVFLQRTMKVDPTY
VNSLIGIQISIEKMSELLEKMGIYSSIVDGKLDVKVPITRTDILHPCDVAEDVGIAYGYN
NIEKILPKTLTVGKEQPLNLVSDLLRVEAGLAGYTEILTFVLHSFNYNYSLMRRPLDGLA
VEISNPKAFEFQLPRTTLLPGVLRTIASNTKQQLPIKIFELSDIVVKDETMDVKARNQRN
FSAGYCGHSSGMENIHGLLDILMKKINLKWKTDYRLVPSENPTFFPKRQAEIYVKDQKAG
IFGMIHPEVLQNFGIGFPVSAIELNIQLIA


>SteCoe_14429(CDS)
ATGCCTAAGGTCACTGTAGCGAAATGTGAGCTTTACAATGAATTAGCGATAGACATGACA
GAAGATGAATTCCGCGACTTATGCTTTGAATTTGGCCTTGAATTAGACGATGTCACTGTG
GAAAAAACAGCTTCAGGCAAAGAAGAAGTCTTCTTTAAGATAGAAGTGGCTGCAAATCGC
TACGACCTGCTATGCATTGAAGGGCTTACTCAAGCACTTAGAGTGTTTATGGGCAAGCAA
AGAATGCCAGAATACCAGCTTGCAACTCCTGCTGAGCCTCTAACCATGACAGTAGAAGTT
GCTACAAGCCAGATTAGACCTTATGTTGTATGTGCAGTATTGAGAAACCTTCACTTCACT
GAAAATTCCTACAACAGCTTCATAGAGCTCCAAGAAAAGCTACATCAGAATATATGCCGT
AAAAGGACACTTGTAGCTATTGGCACCCATGATCTTGACACCCTTTCTGGTCCATTCTTA
TATACTGCCAAACCTCCAAACGATATAAAATTCAGAGCCTTGAATCAGTCTGAAGAGCAT
ACTGCAACTGAGCTTATGAGCATTTATTCAGCTGATGTAAGAATGAAAAAATATGTGCCA
ATCATTTTAGACTCTCCAGTGTATCCAGTGATTTACGATAGCAAAGGAGTAGTACTTTCT
ATGCCACCTATAATTAATGGCGAGCATAGCAAAATCACTCTGAGTACAAAAAATGTTCTT
ATTGAATGCACAGCCACAGACAAGCACAAGGCTCAGATTGTTCTTAACACTATCATTGCA
GCTTTTTCAAAATATTGTGAAAACCCGTTTTCAACTGAAATTGTCAAAGTAGTTTACAGC
GATCATGAAGAAACAACTCCAGTTTTCTTGCAAAGAACAATGAAAGTAGACCCTACCTAT
GTGAATTCATTGATTGGCATTCAGATTTCCATTGAAAAAATGTCTGAGCTTCTTGAAAAA
ATGGGCATCTATAGCTCGATAGTTGATGGAAAGCTCGATGTTAAAGTTCCAATAACAAGA
ACTGATATCCTTCATCCATGTGATGTGGCAGAAGATGTTGGAATTGCTTATGGTTACAAT
AACATTGAAAAGATTCTCCCTAAAACTCTTACTGTAGGAAAAGAGCAACCACTTAATCTT
GTCTCTGATTTATTAAGAGTAGAAGCAGGCTTGGCCGGCTACACTGAAATTCTAACTTTT
GTTTTGCATTCCTTTAATTATAACTATTCACTCATGAGAAGACCTCTTGATGGACTTGCT
GTGGAAATTTCAAATCCTAAAGCTTTTGAGTTTCAGCTTCCAAGAACAACATTACTGCCT
GGGGTTCTAAGAACAATAGCATCAAATACGAAACAACAACTCCCGATTAAGATATTTGAG
TTATCTGACATTGTGGTGAAAGATGAAACAATGGATGTCAAAGCTCGAAATCAGAGAAAC
TTTTCTGCTGGCTACTGCGGACACTCATCCGGTATGGAAAATATTCATGGGCTGCTTGAT
ATACTTATGAAAAAAATAAATTTGAAATGGAAAACTGACTATAGATTAGTTCCTTCTGAG
AATCCAACTTTCTTTCCTAAACGTCAAGCAGAGATATATGTGAAAGATCAAAAAGCTGGG
ATATTTGGGATGATTCACCCTGAAGTGCTTCAAAACTTTGGCATTGGATTCCCTGTTTCT
GCTATTGAGCTCAATATCCAACTTATTGCTTAG