Identifiers and Description

Gene Model Identifier

SteCoe_14461

Standard Name

None

Aliases

None

Description

AAA_11 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig3596.0.g896.054601895401186e-39AAA domain

Tetrahymena ThermophilaTTHERM_000113403.3057006267607343e-37putative helicase required for
processing of tRNAs, rRNAs, a
nd small nuclear RNAs
Saccharomyces CerevisiaeYLR430W2.9374821117108028e-30Presumed helicase and subunit
of the Nrd1 complex (Nrd1p-Nab
3p-Sen1p); complex interacts w
ith the exosome to mediate 3'
end formation of some mRNAs, s
nRNAs, snoRNAs, and CUTs; has
a separate role in coordinatin
g DNA replication with transcr
iption, by associating with mo
ving replication forks and pre
venting errors that occur when
forks encounter transcribed r
egions; homolog of Senataxin,
which is implicated in Ataxia-
Oculomotor Apraxia 2 and a dom
inant form of ALS
WormBaseWBGene000048801.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14461(Protein)
MNKKKVPDIIDLLNEINSPEKNDPVVIDITKETNAKNPPNIKISTKNFIQTSLSSSIPQV
SNIKIPHPNPSLKKPDSKPPINEAKISQPISSPKKNISEDLREKYRDVKLIELDNESESN
PTDIFKKRMPATPLSFENIIYPLPPKANQASDKKPNKSLFDVIQARSNPSHSSALMLSKA
VNEKKEAAALEGLIKWKKTQIVSDLPEKREISGPTDDPIKKPKDQKTQNKEFLKNQNQTI
FDATAFVEKQKKIAQEERKREQIEKKIREKKRLDESKYQESMKNYKYTPVIDDKNSENER
AKRKANINETSSFFNNLLRIDIKNLAESFSEYEVLPLHFNNGAEYIEKFEIPFFGEIRGE
IVSALQQNNMSEYCIVELSCHSTQKSFGFLSVKGRIGGMFDYYQRVQPDDLLLIIPYVQE
DDKKFTTKFENWGYKGTMTLGFVEKTKFQGLYMIKILENSLDEFSGELGFTSAETVSKQC
RVFIIDSCTTMLREYKMIRNAEFLELGNAILNPSKNAFPIIKTQEVEDFLKAVENYYNPS
QIAAIERSCSVISGVVLLQGPPGTGKTHTIRGILSGIMDKYKDQVKILVCAPSNAAIDEI
ARRVVVDNLYGHDGTIKKNLNYLRIGNVKKSAIDIREGKKSIRETPPEVEEITLAHKTEK
EIEGDITSAKLLSLISDQEKIEKMLQIARKNKSKDQVISLEEKKSENLQCLFKEKFSNKD
AVDKKKQVESNILNRANIVFTTLSGAAGKEMVYLKHDFDYVIIDEACQSVELSTLIPLQY
NAKVAILVGDPNQLPATIFSNYSKKSKYDRSLFERLMDGGCQLNMLCTQYRMLKEICDFP
SMTFYDNQLETFEENDRNQAPRWIINKGMWIFNLVTSQESRSTNETSISNTNEAEFIGKL
YHFLAPLHQKRLNIGIITPYKKQVVIIREYFKNFYENDWKIDLEVNTVDGFQGREKDVII
FSSVRSGNTVGFLSDKRRMNVAITRAKYALWIIGSVSCLENNNYWGRLVNYCKERNRIIN
CRAFTEVEDFFIPGQMMDIDYVEEKIVEKKQEPKICEKKKIENKIVRLPVSKEVKKVEMV
EEKVKEKEKTYKSLFDSIIQRAGTKK


>SteCoe_14461(CDS)
ATGAACAAGAAAAAAGTCCCAGATATAATCGATTTACTCAATGAAATCAATTCCCCAGAG
AAAAATGATCCAGTCGTAATTGATATCACCAAAGAAACTAATGCCAAAAATCCTCCCAAT
ATCAAAATCAGCACAAAAAATTTCATTCAAACATCTTTATCTTCATCAATACCACAAGTT
TCAAATATCAAAATCCCACATCCAAATCCTTCATTAAAAAAACCAGACTCAAAGCCCCCA
ATTAATGAAGCTAAAATTTCACAGCCAATCAGCTCACCAAAAAAGAACATATCTGAAGAC
TTAAGAGAAAAATATAGGGATGTTAAACTTATAGAACTAGACAATGAAAGTGAATCAAAT
CCTACTGATATATTTAAAAAACGAATGCCTGCTACACCATTAAGTTTTGAAAATATCATC
TACCCTTTACCACCAAAAGCAAATCAAGCTTCTGATAAAAAACCTAATAAAAGTCTTTTT
GATGTTATACAAGCAAGGTCAAACCCTTCTCATTCCTCAGCGCTAATGCTTTCCAAAGCT
GTAAATGAAAAAAAAGAAGCTGCAGCTTTAGAAGGGTTGATTAAATGGAAAAAAACTCAA
ATTGTCTCTGATTTGCCAGAAAAACGTGAAATTAGCGGACCAACTGATGACCCAATAAAA
AAGCCAAAAGACCAAAAAACTCAAAACAAAGAGTTTTTAAAAAACCAAAACCAAACAATT
TTTGACGCTACAGCTTTTGTCGAAAAACAAAAAAAAATTGCCCAGGAAGAACGTAAAAGG
GAACAAATCGAAAAAAAAATCCGAGAAAAAAAGCGTCTTGATGAAAGTAAATATCAAGAA
AGTATGAAAAACTACAAATACACTCCTGTAATCGATGATAAAAATTCAGAAAACGAACGA
GCTAAAAGAAAAGCAAACATAAACGAAACTTCATCATTTTTTAACAACCTTCTAAGAATT
GATATTAAAAACTTAGCAGAAAGTTTTTCTGAATATGAAGTGTTGCCTTTACATTTTAAT
AATGGTGCTGAGTATATTGAAAAGTTTGAAATTCCGTTTTTTGGAGAAATTCGTGGGGAA
ATAGTCTCAGCCCTTCAGCAAAACAACATGTCAGAGTATTGTATTGTTGAATTGTCATGT
CATTCGACTCAAAAAAGCTTTGGTTTTTTATCAGTAAAAGGAAGAATTGGGGGTATGTTT
GACTATTATCAAAGAGTTCAACCTGATGATTTACTTCTTATAATCCCTTATGTTCAAGAA
GATGATAAAAAATTTACTACAAAATTCGAAAACTGGGGATACAAAGGGACTATGACCCTA
GGTTTTGTAGAAAAAACCAAGTTCCAAGGCCTTTATATGATAAAAATATTAGAAAACAGT
CTTGATGAGTTTTCTGGGGAACTTGGATTTACTAGTGCTGAAACAGTATCTAAACAATGT
AGAGTTTTTATAATAGATTCATGTACAACTATGCTAAGAGAATATAAAATGATAAGAAAT
GCTGAGTTTTTAGAACTTGGGAATGCTATTTTAAACCCTTCTAAAAATGCTTTTCCTATA
ATAAAAACTCAAGAAGTTGAAGATTTTTTAAAAGCTGTTGAAAACTATTACAACCCTTCA
CAAATCGCAGCTATTGAAAGATCATGTTCGGTTATCTCAGGGGTTGTTCTATTACAAGGA
CCACCTGGAACTGGAAAAACCCATACAATCAGAGGAATTTTGTCTGGGATTATGGATAAA
TATAAAGATCAAGTTAAAATCCTTGTTTGTGCTCCCAGTAATGCTGCTATTGATGAAATT
GCTAGAAGAGTTGTTGTTGATAATCTTTATGGACATGATGGAACTATTAAAAAAAACCTG
AATTATCTAAGAATTGGTAATGTGAAAAAAAGTGCAATTGATATAAGAGAAGGGAAAAAA
TCAATTAGAGAAACTCCACCTGAAGTTGAAGAAATCACCTTAGCTCACAAAACTGAAAAG
GAAATCGAAGGGGATATAACAAGTGCTAAGTTATTATCTTTAATTTCTGACCAAGAAAAA
ATAGAAAAAATGCTCCAAATTGCTAGGAAAAACAAATCAAAAGACCAAGTGATTTCCTTG
GAAGAAAAAAAATCTGAAAACCTTCAATGTTTGTTTAAAGAAAAATTTTCTAATAAAGAT
GCAGTGGATAAGAAAAAACAAGTTGAATCTAATATACTTAATAGGGCAAATATAGTTTTT
ACAACTTTAAGTGGTGCAGCAGGTAAAGAAATGGTATATTTAAAACATGATTTTGATTAT
GTTATAATCGATGAAGCATGTCAAAGTGTTGAATTAAGTACTTTGATCCCATTACAATAC
AATGCAAAAGTAGCTATTTTAGTTGGAGATCCAAACCAATTGCCAGCAACAATTTTCAGT
AATTATTCAAAGAAAAGCAAATATGATCGGTCGTTATTTGAAAGATTGATGGATGGAGGA
TGTCAATTGAATATGTTATGCACTCAATATCGTATGTTAAAAGAAATATGCGATTTTCCT
TCAATGACTTTTTATGATAATCAATTAGAAACATTTGAAGAAAATGATAGAAATCAAGCC
CCTAGGTGGATAATCAATAAAGGAATGTGGATTTTCAATTTAGTAACCTCGCAAGAATCT
CGAAGCACTAATGAGACAAGTATTTCTAATACAAATGAAGCTGAGTTCATAGGAAAACTT
TATCATTTCTTAGCCCCATTACATCAGAAAAGGCTTAATATTGGGATTATCACTCCTTAT
AAAAAACAAGTCGTCATTATCAGAGAGTATTTCAAGAATTTCTATGAAAATGACTGGAAA
ATTGACCTTGAAGTTAACACAGTTGATGGTTTTCAAGGTAGAGAAAAAGATGTTATTATT
TTTTCATCAGTTAGGTCTGGGAATACTGTTGGATTTTTATCTGATAAACGTAGAATGAAT
GTTGCGATTACTAGGGCTAAATATGCTTTGTGGATTATAGGCTCAGTATCATGTTTAGAA
AATAATAATTATTGGGGAAGACTTGTAAATTATTGTAAAGAGAGAAATAGGATTATTAAT
TGTCGGGCTTTTACAGAAGTTGAAGACTTTTTTATACCAGGACAAATGATGGATATTGAT
TATGTTGAAGAAAAAATAGTTGAAAAAAAACAAGAACCTAAGATTTGTGAGAAAAAAAAA
ATTGAGAATAAAATTGTGAGGCTGCCGGTCAGTAAAGAAGTTAAAAAGGTTGAGATGGTT
GAAGAAAAGGTCAAGGAAAAAGAGAAAACTTATAAAAGTTTATTTGATTCTATAATCCAA
AGAGCTGGGACTAAGAAATAA