Identifiers and Description

Gene Model Identifier

SteCoe_1469

Standard Name

None

Aliases

None

Description

TKL related kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005786205.665668176358939e-52Protein kinase domain containi
ng protein. Sequence similarit
y to the TKL protein kinase fa
mily (Eisen et al., 2006)."
Oxytricha TrifallaxContig10612.0.g842.031092662734811e-42Protein tyrosine kinase

WormBaseWBGene000010084.248354255291589e-18
Saccharomyces CerevisiaeYAR019C0.0000000000018795288165390832Protein kinase of the Mitotic
Exit Network; localized to the
spindle pole bodies at late a
naphase; promotes mitotic exit
by directly switching on the
kinase activity of Dbf2p; requ
ired for spindle disassembly a
fter meiosis II; relocalizes t
o the cytoplasm upon DNA repli
cation stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1469(Protein)
MSSPKNCVCSSFGYGHYGQLGQPCQTFSLSPIIISIPEPITQISAGDGHTILLTESQKLY
TFGKNTFGQLGLGHSFPISSPSLVSCLQLKKIESVYCGSEHTLALTNEGEIYSWGLNIKG
QLGLGDTNSRNTPTLIESISSRQIQYQGILLEKGERVVQAACGGLHTLVLTDKNKILSCG
HGNNYALGLGVTENVMKFTYIKSLEGLGKIDKIKAGLSHSAAIIQGYLYIWGKAKLLYPE
PTQIIFNTQQQELDGNSPTNYTVEDVGLGLNYTLCINKGNLYAWGEGIGKNSKDPIRILC
EKNPKLISCGTKHAVILSTDNKILVLGTGEYGQCGEVKESLIPTSLRNYDKSQVIQIACG
GYHTVILSQNTPKTISCSLADNCAHSLEIQKLKLYIEEMKKKSRPEHKRGSSNYYLEKDP
VKLAKNTKEIIPCFEIDYSELALDPEPIGRGGYGIVFKGKWRGTTVAIKKMKPEASADRY
NDFIQECQTMLTIRHPNIILFMGACTIQPNICLILEYCGNGSLWDILRNHSTPLPWYLRC
KISLDIAKGVNYLHNFPVPVLHLDLKSLNILLDDSMNAKIADFGWTRSKAELMTNKIGTY
QWMAPEVIQGEEYTEKADVYSFGIILWEIATRKPPFRDLTGIQVSQEVVKNDLRPPVPKR
CPDPFIKLMQKCWDRNPEARPDFQMIIGELENFLKFLERSSVS


>SteCoe_1469(CDS)
ATGTCATCTCCAAAAAATTGTGTATGTTCATCATTTGGTTATGGGCATTACGGACAACTA
GGACAACCTTGTCAAACCTTTTCTTTATCCCCTATCATAATCTCTATACCCGAGCCAATA
ACACAAATATCAGCTGGTGACGGGCATACAATTCTCTTAACAGAAAGTCAAAAACTTTAC
ACATTTGGTAAAAATACATTTGGTCAATTAGGTCTTGGTCATTCATTTCCAATATCATCT
CCAAGTCTTGTATCATGTCTTCAACTAAAAAAAATTGAATCAGTATATTGTGGATCAGAA
CATACACTAGCATTAACAAATGAAGGAGAAATTTATTCATGGGGACTTAATATAAAAGGA
CAATTAGGTTTGGGAGATACAAATAGTAGAAATACTCCAACTTTAATAGAAAGTATAAGT
AGTAGACAGATACAATATCAAGGGATTTTATTAGAAAAAGGAGAAAGGGTAGTTCAAGCA
GCATGTGGTGGACTTCATACATTAGTTTTAACAGACAAAAATAAAATCCTCTCATGTGGT
CATGGGAATAATTATGCTTTAGGCCTTGGGGTAACAGAAAATGTTATGAAATTCACATAC
ATCAAATCACTTGAAGGATTAGGGAAAATTGATAAAATCAAAGCTGGCTTGAGTCATTCA
GCGGCTATAATCCAAGGGTATCTTTATATATGGGGAAAAGCTAAATTATTATACCCAGAG
CCAACACAAATAATTTTTAACACCCAACAACAAGAACTTGATGGGAATTCTCCAACTAAT
TATACAGTCGAAGATGTTGGTCTAGGTCTAAACTATACTCTATGTATTAATAAAGGAAAT
TTATATGCATGGGGTGAAGGTATAGGTAAAAATTCAAAAGACCCAATAAGAATTTTATGT
GAAAAAAATCCTAAACTTATATCATGTGGGACAAAACATGCTGTTATATTATCAACAGAT
AATAAAATATTAGTTTTAGGTACTGGAGAATATGGTCAATGTGGTGAAGTTAAAGAAAGT
TTAATCCCAACAAGTTTAAGAAATTACGACAAATCTCAAGTGATTCAAATTGCTTGTGGA
GGTTATCATACAGTAATTTTATCTCAAAATACCCCAAAAACTATATCATGTTCTTTAGCA
GATAATTGTGCGCATAGTTTAGAAATCCAGAAACTAAAATTATATATTGAAGAAATGAAA
AAAAAATCCCGTCCCGAGCACAAGCGAGGGTCATCAAATTATTATTTAGAAAAAGATCCA
GTCAAACTTGCAAAAAACACTAAAGAAATAATTCCATGTTTTGAAATTGATTACTCAGAA
CTAGCCCTTGATCCTGAGCCTATAGGCCGTGGTGGTTATGGTATAGTATTCAAAGGTAAA
TGGCGAGGAACAACTGTGGCTATTAAAAAAATGAAACCTGAAGCTTCAGCTGATCGATAC
AATGATTTCATCCAAGAATGTCAAACTATGTTAACAATTCGACATCCAAACATCATCTTA
TTTATGGGTGCATGTACAATACAACCAAATATTTGTCTTATATTAGAATATTGTGGTAAT
GGTTCATTATGGGATATACTTCGTAATCATAGTACACCTTTACCATGGTATTTAAGATGC
AAAATATCATTAGATATTGCTAAAGGTGTTAATTATTTACACAATTTCCCAGTCCCGGTT
CTTCATTTGGATTTGAAATCTTTGAATATTTTATTAGATGATTCTATGAATGCTAAAATT
GCTGACTTTGGATGGACAAGGTCAAAAGCTGAATTAATGACTAATAAAATTGGCACTTAT
CAATGGATGGCACCTGAGGTTATACAAGGAGAGGAGTATACAGAAAAAGCTGATGTTTAT
AGTTTTGGGATAATCTTATGGGAAATCGCTACTAGAAAACCCCCTTTTAGAGATTTGACT
GGGATTCAAGTTTCGCAAGAAGTTGTGAAAAATGATTTAAGGCCGCCGGTTCCAAAGAGG
TGTCCTGATCCTTTTATTAAACTTATGCAGAAATGTTGGGATAGAAATCCTGAAGCCCGA
CCTGATTTTCAGATGATAATTGGGGAACTTGAGAATTTTCTCAAATTCTTAGAAAGGTCC
TCAGTGAGTTAG