Identifiers and Description

Gene Model Identifier

SteCoe_14790

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig7554.0.g320Proteasome/cyclosome repeat

WormBaseWBGene000044581.0377033238158346e-53
Saccharomyces CerevisiaeYHR027C4.590938473882946e-48Non-ATPase base subunit of the
19S RP of the 26S proteasome;
may participate in the recogn
ition of several ligands of th
e proteasome; contains a leuci
ne-rich repeat (LRR) domain, a
site for protein-protein inte
ractions; RP is the acronym fo
r regulatory particle

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14790(Protein)
MAELAEKPEKVEKVTQDLSEEDAALKDKLSLLVTQLQECSDSLQVLNQLESEVRNATTSM
TSIPKPLKFLKSHYGTLKTYYSNLPLSDTKTRLANFISVLATTMGNPDGRETLQYLLEGD
ITAAINWGHEYVRTLCGEMQEEYLANHESHKKLLSIVEIILPFLIKSSGECEAIDLLEEI
DVLEKIIDYVDHDNYKRICDYISCTSMYSADPEDHYKTLSVCFQCYLKVNKYPEALRIAL
KINRPEEISQAMESTTDEVTLKQMCYLLARNKYSYRVENEEMAKIISNEFLSQAFIKLAT
DLDVLAPKIPEDIYKSHLEERPRNAQGSTDTAKLSLANTLVNAFVNVGYCNDNIMLTEEK
RWLGRHKDWSNLTASASLGMLLLWNLEEGTSHIDKYQYSRDEFIKSGASLAFGIANAGIQ
NENDPVFALLSDELEKANDKTRVGIIAGLSIAYAGAQREDVLEILTPLVIDTSISIESSA
LAALGLGLLYVGTCNDDVAQAIIQTLMERSETALKSPYARFFALGIGLVFMGQQDRVSTT
LSVINDILSPEIKKYAALTVEGCAYAGSGNVLKVQEMLKVCAEHLEEKDWQYQMVAVISV
SLIAMGENIGTEMVLRTFDHLLQYGTMNIRRATPLAMALLCISNPQVNMIDILSKLSHDP
DTIVAQCAIFAIGMVGAGTNNSRLAGILRQLAGYYSIDDNQLFMVRIAQGLLHLGKGLMT
LDPYQSARFLLSPVALGGILTVLHMMLDIDKLLHDHAHYMLYYLACAIYPRMLVTVDENL
KPLPVQVRVGQAVDTVGQAGNPRTITGFQTHITPVLLSFGEKVELATEEYEPCYEVLENF
IILKKNPNYKPE


>SteCoe_14790(CDS)
ATGGCTGAATTAGCTGAAAAGCCTGAAAAGGTTGAAAAAGTGACTCAGGACTTATCAGAA
GAAGATGCAGCTTTGAAAGACAAACTAAGTTTACTAGTAACCCAGCTTCAAGAATGCTCT
GACTCTTTACAAGTTCTCAATCAACTAGAATCCGAGGTTCGAAATGCTACAACATCAATG
ACTTCAATACCCAAACCTTTAAAATTCCTCAAATCCCATTATGGAACATTAAAAACTTAC
TATAGTAATCTACCTTTATCAGACACAAAAACCCGTTTGGCTAACTTTATATCTGTTCTT
GCAACAACTATGGGTAACCCTGACGGCCGGGAAACTTTGCAATATTTATTAGAAGGGGAT
ATTACAGCAGCAATAAATTGGGGACATGAATATGTGCGAACTCTCTGTGGAGAAATGCAA
GAAGAGTATTTAGCTAATCATGAATCACATAAGAAATTACTTAGTATTGTTGAAATCATC
CTCCCATTTCTTATTAAAAGCTCCGGAGAATGTGAAGCTATTGATTTACTTGAAGAAATT
GATGTGTTGGAAAAAATAATTGATTATGTTGATCATGATAATTATAAAAGAATATGCGAT
TATATATCATGTACTTCAATGTATTCAGCAGATCCAGAAGATCATTATAAGACTTTGAGT
GTGTGCTTTCAATGTTATTTAAAGGTTAATAAATACCCTGAAGCTTTGAGGATAGCTTTG
AAAATCAATAGACCAGAAGAGATCAGCCAAGCTATGGAATCTACTACAGATGAAGTAACT
TTAAAGCAAATGTGTTATTTATTAGCAAGGAATAAATATAGTTACAGAGTAGAAAATGAA
GAAATGGCAAAGATTATATCGAATGAGTTTTTAAGTCAAGCGTTTATAAAATTAGCTACT
GACCTTGATGTTTTAGCACCAAAAATCCCTGAAGATATATATAAATCTCACCTTGAAGAA
AGGCCGAGAAATGCACAAGGGTCTACAGATACGGCCAAGCTAAGCTTGGCAAATACATTA
GTAAATGCTTTTGTAAATGTGGGTTATTGTAACGATAATATTATGTTAACAGAAGAAAAA
AGATGGCTTGGAAGGCATAAAGACTGGTCAAATCTTACAGCATCAGCATCTCTTGGTATG
TTATTATTATGGAACTTAGAAGAAGGGACAAGCCATATTGATAAATACCAATATTCTAGA
GATGAGTTTATAAAATCAGGTGCCTCATTAGCTTTTGGTATTGCAAATGCTGGTATTCAA
AACGAAAACGATCCAGTTTTCGCATTATTATCAGATGAACTTGAAAAAGCTAATGATAAA
ACACGTGTTGGTATAATCGCAGGACTTTCAATTGCATATGCAGGTGCCCAAAGAGAAGAT
GTCCTTGAAATCCTCACACCTTTAGTTATAGATACATCAATATCTATAGAAAGTTCAGCA
CTTGCAGCATTAGGACTTGGGCTTTTATATGTAGGTACATGTAATGATGATGTTGCTCAA
GCTATAATCCAAACATTAATGGAAAGATCAGAAACAGCTCTTAAAAGCCCATATGCTAGA
TTTTTTGCCCTTGGGATAGGTTTGGTGTTTATGGGTCAACAAGATAGAGTATCAACAACT
TTGTCTGTAATAAATGATATACTCAGTCCAGAAATCAAAAAATATGCAGCTCTTACTGTT
GAAGGATGTGCTTATGCAGGTTCAGGAAATGTATTAAAAGTTCAAGAAATGCTTAAAGTA
TGTGCTGAACATTTAGAAGAAAAAGATTGGCAATATCAAATGGTTGCTGTTATATCTGTA
TCACTTATAGCAATGGGTGAGAATATTGGCACTGAAATGGTTTTGAGGACTTTTGATCAT
TTGTTACAATATGGGACTATGAATATACGTAGAGCTACTCCACTTGCTATGGCTTTATTG
TGTATAAGCAACCCACAAGTTAATATGATTGATATTTTATCTAAACTTTCTCATGATCCT
GATACTATTGTTGCTCAATGCGCTATTTTTGCTATAGGCATGGTTGGTGCTGGGACTAAT
AATTCACGTTTAGCTGGAATATTGAGACAATTAGCTGGGTATTATTCTATAGATGATAAT
CAACTTTTTATGGTTAGGATTGCTCAAGGATTGTTACATCTTGGTAAAGGACTTATGACA
CTTGATCCTTATCAGTCTGCTAGGTTTTTATTATCACCTGTTGCCCTTGGGGGGATTCTT
ACTGTTCTTCATATGATGCTGGATATTGATAAATTACTTCATGATCATGCACATTATATG
TTGTATTATTTAGCTTGTGCGATATATCCTAGAATGCTAGTCACGGTTGATGAGAACTTG
AAACCTTTGCCAGTACAAGTTAGAGTTGGACAAGCTGTGGATACTGTTGGTCAGGCTGGT
AACCCAAGGACTATTACTGGATTTCAGACTCATATAACACCAGTACTTCTTTCGTTTGGA
GAAAAAGTCGAACTTGCCACAGAAGAGTATGAGCCTTGTTATGAAGTCCTTGAAAACTTT
ATAATTCTCAAGAAAAATCCCAATTATAAGCCTGAGTAA