Identifiers and Description

Gene Model Identifier

SteCoe_14848

Standard Name

None

Aliases

None

Description

DNA_primase_lrg domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig15489.0.0.g181.185064864233981e-27Eukaryotic and archaeal DNA pr
imase, large subunit

Tetrahymena ThermophilaTTHERM_002437105.74952226429356e-19Eukaryotic-type DNA primase, l
arge subunit family protein
Saccharomyces CerevisiaeYKL045W1.1548224173015786e-17Subunit of DNA primase; DNA pr
imase is required for DNA synt
hesis and double-strand break
repair
WormBaseWBGene000041810.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14848(Protein)
MIIGTSMNKQNLINLSLFYEDHNGTIDLANLENIVNSRYQLLRDVEISRSRSENDETKEK
ERGILKTKDISKKLRPQDDDSIKNDKISHQMLKLSVKNSAEESKWWIETETLLFQNRLKD
LVDPVQLIGPHIKLQIINTIEFPHTQDKKIHPYKIEEDAKVIKAVEAKREAEAKIAAEAK
IAAEEKTGAEAKKIIQTEIDEAKKEPILEGYYKIPLSLGTHLLNYKKKNYFPIRGYFYVL
KCDLELIISEIFRSGLVMELEAAKKIEVTDERLIYIFEKVKNPDMDDGYKIPTGPRNINL
SNIDELAMIHFPPCMKKLYQSLKSNHHLKHYGRLQFGLYLKGLGFPLEESLQFWRKMFAE
KVTAEKFSKNYEYNIKHSYGRLGKMADYSPWTCNKITRMPKPALGEFHGCPFRHSEKGEL
INILMSYQKLENEIKEWILGRHEKEPQLACIKLFESTHPGADYKFTEKIGIYPNAYFDAS
YEYSKS


>SteCoe_14848(CDS)
ATGATAATCGGCACTAGTATGAACAAGCAAAATCTAATTAATCTTAGCTTGTTTTATGAA
GATCACAATGGAACTATTGACTTAGCCAATCTAGAAAATATTGTAAATTCACGATATCAG
CTTCTTCGTGATGTAGAAATTTCGCGCTCTAGAAGTGAAAATGATGAAACAAAAGAAAAA
GAGAGAGGGATTCTTAAAACTAAAGACATTAGTAAAAAATTGCGTCCACAAGATGATGAT
TCTATAAAAAATGATAAAATTTCACACCAAATGCTGAAATTATCAGTCAAAAACTCCGCA
GAAGAATCGAAATGGTGGATAGAGACAGAAACCTTACTTTTTCAAAACAGACTAAAGGAT
TTAGTAGATCCAGTGCAATTAATAGGTCCTCATATAAAGCTTCAAATAATTAACACTATT
GAGTTTCCGCACACTCAAGATAAAAAAATTCATCCTTACAAAATAGAAGAAGATGCAAAA
GTAATAAAAGCAGTAGAAGCAAAAAGAGAAGCAGAAGCAAAAATAGCAGCAGAAGCAAAA
ATAGCAGCAGAAGAAAAAACAGGAGCAGAAGCGAAAAAAATAATACAAACAGAAATAGAT
GAAGCTAAAAAAGAACCAATACTAGAAGGTTATTATAAAATCCCACTAAGCCTAGGCACT
CATTTGCTTAACTATAAAAAGAAAAACTACTTTCCAATAAGAGGATATTTTTATGTTTTA
AAATGTGATTTAGAGTTAATTATTTCAGAGATTTTTAGATCAGGACTTGTAATGGAACTA
GAGGCTGCGAAAAAAATAGAAGTAACAGATGAAAGATTGATTTATATTTTTGAAAAAGTC
AAAAACCCAGACATGGATGATGGATATAAAATTCCTACGGGACCACGAAATATTAATTTG
AGTAACATTGACGAATTAGCAATGATTCACTTTCCCCCATGTATGAAGAAATTATACCAG
AGTTTAAAATCCAATCATCATTTAAAGCATTATGGAAGATTACAATTTGGCTTATATTTG
AAAGGTTTAGGTTTTCCTTTAGAAGAGTCTTTACAGTTTTGGAGGAAAATGTTTGCTGAA
AAAGTCACAGCTGAAAAGTTTTCAAAAAACTATGAGTATAACATAAAACATTCATATGGC
CGACTTGGTAAAATGGCAGATTATTCTCCATGGACTTGCAATAAAATTACAAGAATGCCG
AAACCTGCTTTAGGTGAATTTCATGGCTGTCCTTTTAGACATAGTGAAAAAGGAGAACTT
ATTAATATTCTTATGAGTTATCAAAAATTAGAAAATGAAATCAAAGAGTGGATACTTGGG
CGACATGAAAAGGAACCACAATTAGCATGCATTAAATTGTTTGAATCTACTCATCCTGGA
GCTGATTATAAATTTACTGAAAAAATAGGAATATACCCGAATGCTTATTTTGATGCATCA
TATGAATATTCTAAATCTTAG