Identifiers and Description

Gene Model Identifier

SteCoe_14918

Standard Name

None

Aliases

None

Description

tRNA_anti-codon domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16046.0.g660tRNA synthetases class II (D,
K and N)

WormBaseWBGene000022380

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14918(Protein)
MEGGNPPTDGVAPVSKEEVAPVEVKAEEESKVSKNELKRKQKAEKLAKQKAEKKAKEEEK
KAAAGKKPEETKEVEIDPVEYFNNRVTHINQLQSSGVSVYPHKFEVSLQIPEFIKKYTYL
EKGKRLEEIVSLAGRLTSIREHGKLVFYDLFGDGEKIQIMTDQSVYQGNFEELSQLHRGD
IVGVLGVPARSSPKGKPGELSIIPYKIQILSYCLHMLPAHTGLKDQETRYRQRYLDLMIN
HDVRNIFFTRSKIIKFVKSYLDDRGFLEVETPMMNMIPGGAAAKPFETFHNDLNMKLFMR
IAPELYLKMLVVGGIDRVYEIGKQFRNEGIDLTHNPEFTTCEFYWAYADYNDLIKVTEDM
LSSMVLAIKGSYKFQYHPDGPENPAIEIDFTPPFARKSMIPSIEEAVGVKLPTDLTTEEA
RKVLDTLCIKHHVECGNPRTTPRLLDKLCGHFIEVQCKNPTFITEHPQIMSPLAKYHRSL
PGISERFELFINFHEICNSYTELNNPLKQRELFAEQAKQKADGDDEAQMIDENFCTSLEY
GLPPTAGWGLGIDRLTMLLTDKNNIKEVLLFPAMKPQQ


>SteCoe_14918(CDS)
ATGGAAGGAGGGAATCCACCAACTGATGGTGTAGCACCTGTCTCCAAAGAAGAAGTAGCT
CCAGTCGAAGTGAAAGCTGAAGAAGAGTCCAAGGTCAGCAAAAACGAACTAAAGAGAAAG
CAAAAGGCAGAAAAGCTGGCAAAACAAAAAGCTGAGAAAAAAGCTAAAGAGGAAGAGAAA
AAGGCAGCAGCAGGTAAAAAACCTGAAGAAACCAAAGAAGTAGAAATTGACCCAGTCGAA
TACTTCAACAACCGAGTGACTCACATCAATCAACTTCAATCATCGGGTGTCTCTGTTTAC
CCTCACAAATTCGAAGTATCCTTACAAATCCCTGAGTTCATTAAAAAATACACCTATTTG
GAAAAAGGTAAAAGACTTGAAGAAATTGTTTCATTAGCGGGAAGGCTCACTAGCATCAGA
GAGCATGGAAAACTAGTTTTCTATGACCTTTTCGGTGATGGGGAGAAAATCCAAATCATG
ACCGATCAATCAGTCTACCAAGGAAACTTTGAAGAATTAAGCCAATTACACAGAGGTGAC
ATAGTCGGAGTTCTTGGAGTCCCTGCAAGATCAAGTCCCAAAGGTAAGCCAGGAGAACTG
AGTATTATCCCATATAAAATACAAATCCTCTCATATTGCCTTCATATGCTGCCAGCACAC
ACTGGGCTAAAAGATCAAGAAACAAGGTATCGCCAACGTTATTTAGACTTAATGATCAAC
CATGACGTCAGAAATATTTTCTTTACTAGGTCAAAAATCATCAAATTCGTCAAGTCTTAC
CTGGACGATAGGGGCTTCCTTGAAGTTGAAACACCTATGATGAACATGATCCCAGGAGGT
GCTGCTGCCAAGCCTTTTGAGACCTTCCACAATGATCTAAATATGAAGTTATTTATGAGA
ATTGCCCCAGAGCTGTATTTGAAAATGCTAGTTGTTGGAGGAATTGACAGAGTTTATGAA
ATTGGTAAGCAGTTCAGAAACGAAGGTATTGATCTAACCCATAACCCTGAGTTCACAACT
TGTGAGTTTTATTGGGCTTATGCTGATTATAATGATCTGATTAAAGTTACTGAAGACATG
CTGAGCTCTATGGTTTTGGCTATAAAAGGAAGTTATAAGTTCCAGTATCATCCTGATGGT
CCTGAAAATCCAGCAATCGAGATTGATTTCACCCCACCTTTTGCTAGAAAATCTATGATC
CCTTCGATTGAAGAAGCAGTTGGAGTTAAGCTTCCTACAGATTTAACTACTGAAGAAGCA
AGAAAAGTGTTAGACACCTTGTGTATTAAACATCATGTTGAGTGTGGAAACCCAAGAACA
ACTCCAAGACTTTTAGATAAACTATGTGGGCATTTTATTGAAGTCCAGTGCAAGAACCCA
ACTTTTATTACTGAGCATCCTCAGATTATGAGTCCTTTGGCTAAATACCATAGAAGTTTA
CCTGGGATCAGTGAAAGGTTTGAACTTTTTATCAATTTCCATGAAATCTGTAACTCTTAT
ACTGAACTCAATAACCCACTTAAACAAAGAGAGCTTTTCGCTGAACAGGCCAAGCAAAAA
GCTGATGGAGATGATGAAGCTCAAATGATTGATGAAAATTTCTGTACCTCATTGGAATAT
GGACTACCTCCTACTGCTGGATGGGGATTAGGAATTGACAGGCTTACTATGCTACTTACT
GATAAAAACAATATTAAGGAAGTCTTGTTGTTCCCTGCGATGAAGCCTCAGCAATAG