Identifiers and Description

Gene Model Identifier

SteCoe_14958

Standard Name

None

Aliases

None

Description

Pescadillo_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig6540.0.g481.0377033238158346e-53Pescadillo N-terminus

Tetrahymena ThermophilaTTHERM_006284204.1863939993042314e-51Nucleolar protein involved in
rRNA processing and 60S
ribos
omal subunit biogenesis
WormBaseWBGene000030633.0144087850653746e-40
Saccharomyces CerevisiaeYGR103W7.281290178321643e-33Component of several different
pre-ribosomal particles; form
s a complex with Ytm1p and Erb
1p that is required for matura
tion of the large ribosomal su
bunit; required for exit from
G0 and the initiati
on of cell proliferation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14958(Protein)
MGKLIKKGVKSDSAKYYTKGKAMRKLQLNTQQFHRLCILKGIYPKDPKKKKDQAKTYYHI
KDIKFLAHEGLLEKFRDIDCWLHKLRKAKIRKDVIKAEKIQENMPTYTLTHLVKERYPRF
IDAVRDLDDALSLICLFASCPSNKDLKISSEMTKMSERLWNEFELYLMASKSIRKCFLSI
KGIYYQAEIKGQQVTWLVPYQFTQHLPFDVDYSIMTTFLEFYHTLLKFINYKLYQELSMP
YPPCLTENLDRLLATAVLPAEFQFDPIFNTDPDIQKIAKQQKDNEKAKNIFKGFVFLLGR
ETPRYSLELVIRSCGGKIVENDCDSVTHQVVDRPLSILNPTRETIQPQWVYDSLNFCFLM
PLAQYKPGNTLPPHLSPFVDYKSEGYVPERLQEIMKLKGEDIEEAKKIEKERKQLGKIMM
TRKIRGLYTKMKLVNKRKKIMIDRLKKRREHSSDNS


>SteCoe_14958(CDS)
ATGGGAAAGCTGATCAAAAAAGGAGTGAAAAGCGATTCAGCCAAGTACTATACCAAAGGA
AAAGCAATGCGTAAACTCCAGCTTAACACTCAGCAATTCCATAGACTGTGTATCCTCAAA
GGCATATACCCAAAAGATCCTAAGAAAAAGAAAGACCAAGCAAAAACTTACTATCACATC
AAAGATATTAAGTTTCTAGCCCATGAGGGTCTCTTAGAAAAATTCCGAGACATCGATTGT
TGGTTGCATAAGCTCCGTAAAGCCAAAATCCGTAAAGACGTCATCAAGGCTGAAAAGATC
CAAGAAAACATGCCAACTTACACATTAACCCATTTAGTAAAAGAGCGATACCCAAGGTTT
ATCGATGCAGTTCGTGACCTAGACGACGCTCTAAGTCTTATATGTTTATTTGCAAGTTGT
CCAAGTAATAAAGATCTAAAAATCTCAAGCGAAATGACTAAAATGAGCGAACGACTTTGG
AATGAATTCGAACTTTATCTCATGGCTTCAAAGTCAATAAGAAAATGTTTTTTGTCAATT
AAAGGAATATATTATCAAGCTGAAATCAAAGGACAACAAGTTACTTGGTTGGTACCATAT
CAATTCACTCAACATTTACCTTTTGATGTTGATTATTCTATAATGACAACTTTTCTTGAG
TTTTATCATACATTATTGAAATTCATTAATTATAAACTTTATCAAGAACTATCAATGCCT
TATCCTCCTTGTTTGACTGAGAATTTAGATAGGCTTTTAGCTACAGCTGTATTGCCAGCT
GAGTTTCAGTTTGACCCGATTTTTAACACTGACCCGGATATACAAAAGATTGCCAAGCAA
CAAAAGGATAATGAAAAAGCTAAGAATATTTTTAAAGGGTTTGTTTTCTTGTTAGGAAGA
GAAACACCTAGATACTCATTAGAATTGGTTATAAGGTCTTGTGGAGGTAAAATTGTTGAA
AATGATTGTGATAGTGTTACGCATCAGGTTGTTGATAGACCATTGAGTATTCTTAATCCA
ACAAGAGAAACTATTCAACCACAATGGGTTTATGATAGTTTGAATTTCTGCTTTTTAATG
CCTTTAGCACAGTATAAACCAGGGAATACACTTCCTCCACACTTGTCTCCATTTGTTGAT
TATAAAAGTGAAGGGTATGTTCCTGAAAGGCTACAAGAGATAATGAAGCTAAAAGGTGAG
GATATAGAAGAAGCTAAGAAAATTGAAAAAGAGCGCAAACAGCTAGGCAAGATTATGATG
ACTCGAAAGATCCGAGGCTTGTACACTAAGATGAAACTTGTGAACAAACGCAAAAAAATA
ATGATCGACCGTCTTAAAAAACGCAGAGAACACTCTTCAGATAATAGTTAG