Identifiers and Description

Gene Model Identifier

SteCoe_14964

Standard Name

None

Aliases

None

Description

MORN domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005298804.0795586671775603e-41Protein with predicted MORN do
mains localized throughout the
protein and/or associated wit
h other domains having a predi
cted function
Oxytricha TrifallaxContig19213.0.g113.0144087850653746e-40MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_14964(Protein)
MESGSLEKNYEQLWKRNDKKAQKNGPHKGIYWVKKREPEEDGKIKGEKWFHSCKYTGEWN
ENQKEGYGTMTYQNGDKYEGEWRSNQRNGHGTLWKLANKKGEKYKRIYTGDWENDKMSGQ
GSYFYENDDRYDGFWMNGKRHGQGRMIYSNGDIYEGQWIDDMKEGYGTYTKPSGECFEGY
WLRDMKHGQGSFYYGNSNRIYVGEWVENVPKCGIFTEVEDDEVSFPNRPKYFTDADEPAP
LPGLKLRNPNQVLKDAIEAIRVDQEDASLSH


>SteCoe_14964(CDS)
ATGGAAAGTGGCTCATTAGAAAAAAACTACGAGCAGTTATGGAAAAGAAACGATAAAAAA
GCTCAGAAAAATGGTCCGCACAAAGGCATCTACTGGGTAAAAAAGCGAGAACCCGAAGAA
GATGGGAAAATCAAAGGAGAAAAGTGGTTCCATAGCTGTAAATATACAGGCGAATGGAAT
GAGAACCAAAAAGAAGGCTATGGGACAATGACATACCAAAACGGAGACAAATATGAAGGT
GAATGGCGTAGCAATCAAAGAAATGGTCATGGGACTCTATGGAAACTCGCTAACAAAAAA
GGTGAAAAATACAAACGAATCTATACAGGCGATTGGGAAAATGATAAAATGTCAGGTCAA
GGGAGTTACTTTTATGAAAACGATGATCGATATGATGGTTTCTGGATGAATGGTAAACGT
CATGGTCAAGGTCGTATGATTTATAGCAATGGGGATATATATGAAGGTCAATGGATTGAT
GATATGAAAGAAGGTTATGGAACATATACAAAACCTAGTGGAGAATGCTTTGAAGGATAT
TGGCTTAGAGATATGAAACATGGACAAGGAAGTTTTTATTATGGGAATAGCAATAGAATT
TATGTTGGAGAATGGGTTGAAAATGTTCCAAAATGTGGGATTTTTACTGAAGTTGAAGAT
GATGAAGTATCGTTTCCTAATAGACCAAAATATTTTACTGATGCTGATGAACCTGCACCA
CTTCCTGGGCTTAAACTTAGAAACCCGAATCAGGTGCTTAAGGATGCTATTGAGGCAATA
CGGGTTGACCAAGAGGATGCATCTCTTAGCCATTAG