Identifiers and Description

Gene Model Identifier

SteCoe_15273

Standard Name

None

Aliases

None

Description

AAA domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1478.1.g582.0842828425817514e-52ATPase family associated with
various cellular activities (A
AA)

Tetrahymena ThermophilaTTHERM_000880101.1379798735078682e-50ATPase, AAA family protein
WormBaseWBGene000179811.368539471173853e-44
Saccharomyces CerevisiaeYPL074W2.2273635617957438e-39Putative ATPase of the CDC48/P
AS1/SEC18 (AAA) family; locali
zed to the cortex of mother ce
lls but not to daughter cells;
relocalizes from cytoplasm to
plasma membrane foci upon DNA
replication stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15273(Protein)
MDPSIFNTTFQELCINDHSSTQNLLFFPLLASLPPQEKLKITLPPLEKPKKPIKTVSLEK
ELSNSSNIKPIPWRPNGRKRQNDSPQDQTKAFDPSENSRTKLPNDSESDSRRRKIQENGE
FVSAHSLISTKPPQNSSPGPKNPLKKPFTCPLRGTNPSEAQKEDSKITGIEEKLIEMIES
EIITRNPCVKWDDIAGLEFAKKTVNEAIVWPLKRPDLFKGIRAPPKGLLLFGPPGTGKTM
IGKAIASEVSATFFSISASSITSKWVGEGEKLVRVLFALAIKNQPSIIFIDEIDSLLSSR
NDGEQEGSRRIKTEFLVQMDGAGTNPNDRILLIGATNRPQELDEAMRRRLAKRMFIPLPN
ADGRRAILKNLLKSVPNVIGDKEVEEIVKRSKGYSGSDMKNLCTEASMVPLRDIGDISNL
VVDEIPPVGLEHFIIALDGIRSSVSQTDIQQLLLWNKDFGSFQFDFSSLDT


>SteCoe_15273(CDS)
ATGGATCCAAGTATTTTTAACACAACTTTTCAAGAATTATGCATAAACGATCATTCCTCA
ACCCAAAACCTACTATTTTTTCCTTTACTAGCTTCTTTACCCCCTCAAGAAAAGTTAAAA
ATTACTCTGCCACCATTAGAAAAACCTAAAAAGCCAATCAAAACCGTATCATTAGAAAAA
GAATTGTCAAATAGTTCAAACATAAAACCAATTCCTTGGCGACCAAATGGACGTAAGCGG
CAAAACGACTCTCCTCAAGACCAAACCAAAGCTTTTGACCCAAGCGAGAACTCCCGCACA
AAACTACCAAACGACTCAGAAAGTGACTCCCGCCGAAGAAAAATCCAAGAAAACGGGGAA
TTCGTCTCAGCCCACAGTCTAATTTCCACAAAACCCCCGCAAAATTCATCCCCAGGGCCA
AAAAACCCTTTAAAAAAGCCTTTCACCTGTCCTTTACGTGGGACAAACCCATCCGAGGCA
CAAAAAGAAGATTCTAAAATCACTGGCATAGAAGAAAAACTAATCGAAATGATTGAAAGT
GAAATCATAACAAGAAATCCATGTGTTAAATGGGATGATATAGCAGGTCTTGAATTTGCT
AAAAAAACAGTCAATGAAGCAATTGTTTGGCCATTAAAACGACCTGATCTTTTTAAAGGT
ATAAGAGCTCCACCTAAAGGTCTTTTATTATTTGGTCCACCAGGTACAGGTAAAACTATG
ATAGGTAAAGCTATAGCAAGTGAAGTTTCAGCTACATTTTTTAGTATCTCAGCTAGTTCA
ATAACCTCAAAATGGGTAGGTGAAGGGGAAAAATTAGTTCGAGTTCTTTTTGCTTTAGCA
ATAAAAAACCAGCCATCAATAATTTTTATAGATGAAATTGACTCTTTATTAAGCAGTAGA
AATGATGGAGAACAAGAAGGGAGCAGAAGGATAAAAACTGAGTTTTTAGTACAAATGGAT
GGAGCTGGGACTAATCCTAATGATAGGATTTTACTTATTGGAGCTACGAATAGACCACAG
GAACTTGATGAAGCTATGAGAAGGAGGCTTGCGAAAAGAATGTTTATACCTTTACCTAAT
GCTGATGGTAGACGAGCTATATTGAAAAATCTTTTGAAATCTGTACCTAATGTGATTGGA
GATAAGGAAGTTGAGGAGATTGTTAAAAGATCTAAAGGGTACTCTGGAAGTGATATGAAA
AATTTGTGCACAGAAGCTAGTATGGTACCTTTAAGGGATATTGGGGATATTTCAAATTTG
GTTGTTGATGAAATACCTCCTGTTGGACTTGAACATTTTATAATAGCACTTGATGGGATT
AGGTCTTCGGTATCACAGACTGATATACAACAACTTCTTTTATGGAATAAAGATTTCGGA
TCTTTTCAGTTTGATTTTTCTTCACTTGATACATAG