Identifiers and Description

Gene Model Identifier

SteCoe_15287

Standard Name

None

Aliases

None

Description

Histone domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig9358.0.g548.985825944049381e-37Core histone H2A/H2B/H3/H4

WormBaseWBGene000019466.639677199580735e-36
Tetrahymena ThermophilaTTHERM_001891809.854154686111257e-34Histone H3; one of the four hi
stones (H2A, H2B, H3 and H4) t
hat comprise the protein core
of the eukaryotic nucleosome;
lysine-9 methylated in heteroc
hromatin; encoded protein iden
tical to Hht1p; upregulated in
HHT3 knockouts
Saccharomyces CerevisiaeYNL031C7.281290178321643e-33Histone H3; core histone prote
in required for chromatin asse
mbly, part of heterochromatin-
mediated telomeric and HM sile
ncing; one of two identical hi
stone H3 proteins (see HHT1);
regulated by acetylation, meth
ylation, and phosphorylation;
H3K14 acetylation plays an imp
ortant role in the unfolding o
f strongly positioned nucleoso
mes during repair of UV damage

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15287(Protein)
MARTKQTARKTPAGKTPKKHLATKAAKKVTQASTTSGVKKPHRFRPGTVALREIRKYQKS
TELLVRKLPFQRLVREIAQEYKTDLRFQSSAVLALQEAAEAYLVSLFEDTNLCAIHAKRV
TIMPRDMQLARRIRGERA


>SteCoe_15287(CDS)
ATGGCACGCACCAAGCAAACCGCAAGAAAAACCCCAGCAGGAAAGACCCCAAAGAAACAT
TTGGCAACTAAGGCAGCTAAAAAAGTTACTCAAGCTTCAACAACATCAGGTGTTAAAAAA
CCTCATCGTTTCCGCCCTGGTACTGTAGCTTTACGTGAAATAAGAAAGTATCAAAAAAGC
ACTGAATTACTTGTCAGAAAACTACCTTTCCAAAGATTGGTTAGAGAAATTGCCCAGGAA
TATAAGACAGACTTAAGATTCCAAAGCTCAGCTGTACTTGCATTGCAGGAAGCTGCTGAA
GCTTATTTGGTTAGTTTGTTTGAAGATACTAACTTATGCGCTATTCATGCTAAGAGAGTG
ACTATTATGCCAAGAGATATGCAATTGGCGAGGAGAATTAGAGGTGAAAGAGCTTAA