Identifiers and Description

Gene Model Identifier

SteCoe_1541

Standard Name

None

Aliases

None

Description

Melibiase_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • hydrolase activity, hydrolyzing O-glycosyl compounds (IEA) | GO:0004553

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19465.0.g676.375869581278994e-59Melibiase

Tetrahymena ThermophilaTTHERM_000437701.2806276389220833e-57alpha-galactosidase, putative
WormBaseWBGene000110957.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1541(Protein)
MSLLLCLFFSPALSLNNGLGRTPQMGWNSWNHFGCNINETVFQIAGQQLIETGLSKLGYI
YVNIDDCWSLKSRDANGQIVPDPIKFPNGITGLASYLHNIGLKLGIYSDAGTETCQGYPG
SLGHEVTDANSFASWNVDYLKYDNCYNENIPALKRYPPMRDALNATNREIFYSICNWGQE
NPWVWGNATGNSWRTTQDISDHWSSMMINFYMNSRYAKYAGPGGWNDPDMLEVGNGGMTF
NEYVTHFSLWAMVKAPLIIGCDMGTISQSTLSILNNADIIALNQDPLGVQAECINGCDYA
NYISGAQANVFVVPLAGGDKAVSITNWGTYNMTYTFDLTKIGVTGQATIKDLWTKEVQTS
NAIHVTGLQKHSVKVYRITSNSLDI


>SteCoe_1541(CDS)
ATGTCACTTTTGCTGTGTTTATTTTTCTCTCCAGCCCTATCTTTAAACAATGGTTTGGGT
CGTACCCCTCAAATGGGATGGAATTCTTGGAATCACTTTGGTTGCAATATAAACGAAACT
GTATTTCAAATTGCAGGTCAACAGCTTATTGAAACAGGACTTAGTAAGCTTGGATATATC
TATGTAAACATTGATGATTGTTGGTCTTTAAAATCAAGAGATGCTAATGGTCAAATAGTT
CCTGATCCAATAAAATTCCCAAATGGTATAACAGGTCTTGCTAGTTATTTGCATAATATA
GGGCTTAAATTAGGGATATATTCAGATGCTGGAACAGAAACTTGTCAAGGATATCCAGGG
TCTTTGGGTCATGAGGTTACTGATGCAAATAGTTTTGCTTCATGGAATGTTGATTATTTG
AAATATGATAATTGTTATAATGAAAACATACCTGCTTTAAAAAGATACCCACCTATGAGA
GATGCACTTAATGCTACTAATAGAGAGATTTTCTATTCAATATGCAATTGGGGACAAGAA
AATCCATGGGTATGGGGAAATGCTACAGGGAATAGTTGGAGGACAACTCAAGATATTAGT
GACCATTGGTCAAGTATGATGATTAATTTCTATATGAATTCAAGATATGCGAAATATGCT
GGACCTGGAGGTTGGAATGATCCTGATATGTTGGAAGTTGGAAATGGAGGAATGACTTTT
AATGAATATGTTACCCATTTCTCATTATGGGCTATGGTCAAAGCACCACTTATTATCGGT
TGTGATATGGGGACTATTAGTCAGAGTACACTTTCGATATTAAATAATGCAGATATTATC
GCACTTAATCAAGACCCACTTGGTGTACAAGCTGAATGTATTAATGGCTGTGATTATGCA
AACTATATTTCTGGAGCTCAAGCTAATGTCTTTGTTGTTCCTTTAGCTGGAGGAGATAAA
GCTGTTAGTATAACAAACTGGGGAACTTATAACATGACTTATACTTTCGATTTAACTAAA
ATTGGAGTAACAGGACAAGCTACAATAAAAGATTTATGGACTAAAGAAGTACAGACATCA
AATGCTATTCATGTAACTGGCTTGCAAAAACATTCAGTGAAAGTATATAGAATTACTTCA
AATTCATTAGATATATAA