Identifiers and Description

Gene Model Identifier

SteCoe_15423

Standard Name

None

Aliases

None

Description

tRNA_anti-codon domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14779.0.g812.1151310375910805e-19Replication factor-A C termina
l domain

Saccharomyces CerevisiaeYAR007C1.5628821893349888e-18Subunit of heterotrimeric Repl
ication Protein A (RPA); RPA i
s a highly conserved single-st
randed DNA binding protein inv
olved in DNA replication, repa
ir, and recombination; RPA pro
tects against inappropriate te
lomere recombination, and upon
telomere uncapping, prevents
cell proliferation by a checkp
oint-independent pathway; role
in DNA catenation/decatenatio
n pathway of chromosome disent
angling; relocalizes to the cy
tosol in response to hypoxia
WormBaseWBGene000175460.000000000005109089028063325
Tetrahymena ThermophilaTTHERM_001068900.0000000001026187963170189Encodes Replication Protein A
(RPA). Protein involved in rec
ombination and DNA repair

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15423(Protein)
MILTQNAIAKILNGAKQSEFRPTVQIIEASLLSKGIKLIISDGESCTQAISLCPDITRSN
YNFYTNKIVNLTNYQANPINGYVCIKVYDIELIQDSEEIIGDPKALEQKVQEEVPKSIVY
NFIEKKVKTETFDENEKQNPDNFYAPISALSITSSDWTIKARVIKKSNIKMFQNNRGDGK
LFSCVLIDANNDQIQATFFNQAVEIFEHRIREGRVYTFSGGNVKHSNKNFFSVNDISISF
ERNSLINEVPDDMKIPRIKFEFVPLNSLPNLPINKTVDICVIILEIDKPIQIMTKKGVHM
FKRTMTVTDFTACSIEVTLWEELALRPEFDTFDIGEKPIVCFKTLKLKDFNKLSLSSNFD
STEIFFNVQGIIEAENLQAWKLRQTRIYPSTPLSEKKNCDIKLKTTTEIKDEWDNTMNSN
KTENFRLIGIIGKIPINETRNIWYESCTNGTCKKKVNKNSDGLFICDSCNVTFEKCKYRY
SCSLTISDCCGHIFATAFDEIMTELLKITATEMYEQVMNMPEKAEDTLAAVFGKYVNVSV
KATVAENKAGYKFIIKSFDPLDPSAISKILLSECIIKAK


>SteCoe_15423(CDS)
ATGATTTTGACGCAAAATGCTATAGCGAAAATCCTCAATGGCGCGAAACAGTCTGAGTTC
CGGCCAACTGTGCAAATAATCGAGGCATCTCTTCTAAGCAAAGGAATAAAACTAATAATT
TCTGATGGTGAAAGCTGCACTCAAGCCATTTCCTTATGTCCTGACATAACACGATCTAAT
TATAACTTTTATACAAACAAAATAGTGAATCTAACAAATTACCAAGCTAATCCTATAAAC
GGATATGTTTGCATTAAAGTTTACGATATTGAACTAATCCAAGATAGTGAAGAAATTATA
GGAGATCCAAAAGCTTTAGAACAAAAAGTTCAAGAAGAGGTTCCAAAAAGTATTGTATAC
AATTTTATAGAAAAGAAAGTCAAGACTGAGACTTTTGATGAGAATGAAAAGCAGAATCCT
GACAATTTTTACGCGCCAATAAGCGCTTTGAGTATAACAAGTTCTGATTGGACAATTAAA
GCTAGAGTAATTAAAAAGTCTAATATCAAAATGTTCCAAAACAACAGAGGTGATGGTAAA
CTTTTTAGTTGTGTGCTTATAGATGCAAACAATGATCAGATACAAGCTACATTTTTTAAC
CAAGCAGTGGAAATTTTTGAGCACAGAATTCGGGAAGGCAGAGTTTATACTTTTTCTGGA
GGTAATGTTAAGCACTCGAATAAAAATTTTTTTAGTGTGAATGATATCTCAATCAGCTTT
GAAAGAAACTCACTCATTAATGAAGTACCTGATGATATGAAAATCCCAAGAATCAAATTT
GAATTTGTACCTTTAAATAGTCTCCCAAATCTCCCTATAAACAAAACTGTGGACATATGT
GTAATAATTTTAGAAATAGACAAGCCTATTCAAATCATGACAAAAAAAGGTGTTCATATG
TTTAAGCGAACAATGACTGTTACTGATTTTACAGCTTGCTCTATAGAGGTGACTTTATGG
GAAGAGCTAGCATTAAGGCCAGAATTCGATACTTTTGATATAGGAGAAAAACCAATTGTA
TGCTTTAAAACTCTCAAACTCAAAGACTTTAACAAATTAAGTCTTTCTAGTAACTTTGAT
TCAACGGAAATATTTTTCAATGTCCAGGGGATAATAGAAGCTGAGAATCTTCAAGCTTGG
AAACTTCGCCAGACAAGAATATATCCATCCACTCCTCTGTCAGAAAAAAAAAACTGTGAT
ATAAAACTTAAGACTACTACTGAAATTAAAGATGAATGGGATAATACAATGAATAGTAAC
AAAACTGAAAATTTCAGACTTATTGGGATTATAGGCAAAATCCCAATAAATGAGACTAGA
AATATTTGGTATGAGTCTTGTACGAATGGTACATGCAAAAAGAAAGTAAATAAAAATTCA
GATGGGCTTTTCATATGTGATAGCTGCAATGTTACATTTGAAAAATGTAAATATCGTTAC
TCCTGTAGTCTGACTATTAGTGACTGTTGTGGGCACATTTTTGCTACAGCTTTTGACGAG
ATAATGACAGAATTACTTAAAATTACTGCTACTGAAATGTATGAGCAGGTAATGAATATG
CCAGAAAAAGCTGAGGATACCCTTGCTGCCGTTTTTGGAAAGTATGTTAATGTTTCAGTT
AAGGCTACTGTAGCCGAAAACAAAGCTGGATACAAGTTTATCATAAAAAGTTTCGACCCA
CTAGATCCTTCTGCTATTAGTAAAATTCTTTTAAGCGAATGCATAATCAAAGCTAAATAG