Identifiers and Description

Gene Model Identifier

SteCoe_15463

Standard Name

None

Aliases

None

Description

Ax_dynein_light domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_008412108.194012623990515e-40Light chain subunit of inner a
rm dynein (IAD) complex 2
Oxytricha TrifallaxContig21381.0.g788.194012623990515e-40Axonemal dynein light chain

WormBaseWBGene000183072.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15463(Protein)
MASGSQSLVKYDTKIQVSTSLKGRGKSPRKIPGKPNVPPDKAQIEDVLNSVLPPRESTED
GQLWVQYVSSTPATTQDVIKLQEQLDTLLEARQARETGICPVREELYSQAFDELIRQVTI
ICTERGLLLLRVRDELRMTIQAYQTLYESSIAYGMRKALQAEQWRAETDVKIKTLSEECE
NLKKEVEQLEQEIEDIEINERDREEKAAKLHYEEVEFRKKTNQRLKENLEAILATPNK


>SteCoe_15463(CDS)
ATGGCAAGTGGGTCTCAATCTTTAGTTAAATACGATACTAAAATACAAGTATCGACATCA
TTAAAAGGTCGTGGAAAATCTCCTCGTAAAATCCCAGGTAAGCCTAATGTACCTCCAGAC
AAGGCTCAAATTGAAGATGTCCTCAATTCAGTTTTGCCTCCAAGAGAAAGTACTGAAGAT
GGTCAACTTTGGGTGCAATATGTGAGTTCTACACCAGCAACAACTCAAGATGTTATTAAA
TTACAAGAACAACTTGATACTTTACTTGAAGCTAGACAAGCAAGAGAAACTGGCATATGT
CCAGTTCGTGAAGAATTATATAGTCAAGCTTTTGATGAATTGATTAGACAAGTTACAATT
ATATGCACAGAAAGAGGATTATTATTGTTAAGAGTAAGAGATGAACTTAGAATGACTATT
CAAGCATATCAAACTTTATATGAAAGTAGTATTGCATATGGTATGAGAAAAGCTTTACAA
GCAGAACAATGGAGAGCTGAAACTGATGTGAAAATCAAAACTCTTTCTGAAGAATGTGAG
AATTTGAAAAAAGAAGTAGAACAACTTGAACAAGAAATTGAAGATATTGAAATTAATGAA
AGGGATAGAGAAGAAAAAGCTGCTAAACTTCATTATGAGGAAGTTGAGTTTAGGAAAAAA
ACTAATCAAAGACTTAAAGAAAACCTTGAAGCAATCCTTGCAACACCTAATAAATAA