Identifiers and Description

Gene Model Identifier

SteCoe_15530

Standard Name

None

Aliases

None

Description

IBB domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYNL189W1.9006199352650016e-55Karyopherin alpha homolog; for
ms a dimer with karyopherin be
ta Kap95p to mediate import of
nuclear proteins, binds the n
uclear localization signal of
the substrate during import; i
nvolved in cotranslational pro
tein degradation; binds riboso
me-bound nascent polypeptides;
Srp1p and Sts1p couple protea
somes to nascent polypeptides
emerging from the ribosome for
cotranslational degradation
Oxytricha TrifallaxContig20249.0.g401.9006199352650016e-55Armadillo/beta-catenin-like re
peat

Tetrahymena ThermophilaTTHERM_010162201.1379798735078682e-50Armadillo/beta-catenin-like re
peat family protein; Karyopher
in/Importin alpha family membe
r
WormBaseWBGene000020743.392270193026015e-47

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15530(Protein)
MLESRAKSFMQAYDVEDIKRRKEENEVELRKTKRADLVTKRRNLEQTEKQWIKVNEIFKP
SYSLSDLPELLEAMHSPLEEKHLFAAQGFRKILSLEHNPPIQELIDTGILPYLIEWIQKF
DYPQLQYESAWTITNIASGTHHHCQVIVEKGCVPLLIQMMNSNNEEVREQAVWALGNIGG
DAAHCRDVILQNNGLPLLIKCLKSSTKHSMIKNASWTISNLCRGKPAPMYEMVKDAMPVL
AEVVKSQHDSEILSDSLWALSHLSEGSEEKVDYLISTGIIERVIQLLNHHLYNIQLPAIR
VIGNVVTGNEAQTQLIINLNGVEALSTLLNSAKKNTQKEAVWSISNICAGTKEQLDRLIS
ADVIPRLVNCAYSSDKDIKKETVWALSNAAAGGRPDQVYKFVQSGIVQALCSLLEETDVK
IVSVAIEGLNRILRCGKENFSTDGGSSEFANVVEDCNGLSKLEKLQQHPNTQIYEKARNM
IENYFQIEPDENESLIQMIKGCSQFNL


>SteCoe_15530(CDS)
ATGCTTGAATCCCGAGCTAAAAGTTTCATGCAGGCATATGATGTTGAAGACATCAAACGT
CGAAAAGAGGAAAATGAGGTAGAGCTTCGTAAGACCAAACGCGCTGATCTTGTTACTAAA
AGGAGAAATCTAGAACAGACCGAAAAGCAATGGATAAAAGTAAATGAGATTTTCAAGCCG
AGTTACTCATTGAGCGACTTGCCTGAACTTCTTGAAGCCATGCATTCACCATTAGAAGAA
AAGCACTTGTTTGCCGCTCAGGGTTTCCGTAAAATTCTTAGTCTAGAGCATAATCCCCCA
ATCCAAGAGCTCATAGATACTGGAATTCTCCCTTACCTAATTGAATGGATTCAGAAATTC
GACTATCCACAACTACAATATGAAAGTGCATGGACAATAACTAACATAGCTTCTGGAACT
CATCATCATTGTCAAGTCATAGTAGAAAAAGGGTGTGTTCCTTTACTTATACAAATGATG
AACTCAAATAATGAGGAAGTTAGAGAACAAGCAGTATGGGCTTTAGGCAATATAGGTGGA
GATGCAGCTCATTGTCGAGATGTAATTCTTCAAAATAATGGTCTTCCATTACTTATAAAA
TGCTTAAAATCTAGTACTAAGCATAGTATGATAAAAAACGCTAGCTGGACAATAAGCAAT
CTTTGTAGAGGTAAACCCGCACCAATGTATGAAATGGTTAAAGACGCTATGCCTGTTCTA
GCTGAAGTTGTCAAATCTCAACATGACTCAGAAATACTTAGTGATTCTCTTTGGGCTCTT
TCACATCTTTCAGAAGGAAGTGAAGAAAAAGTTGATTATTTAATATCAACTGGTATAATT
GAAAGAGTTATCCAATTACTTAATCATCATTTATACAATATTCAACTTCCAGCTATAAGA
GTTATTGGTAATGTCGTTACAGGAAATGAAGCTCAAACTCAATTGATTATAAATCTTAAT
GGAGTTGAAGCTTTATCTACATTATTGAATTCAGCAAAGAAAAATACTCAAAAAGAAGCG
GTTTGGAGTATATCAAATATCTGTGCAGGTACTAAAGAGCAACTTGATAGACTTATTAGT
GCTGATGTTATACCAAGACTTGTTAATTGTGCTTATAGTAGTGATAAAGATATAAAAAAA
GAAACTGTTTGGGCTTTAAGTAATGCTGCTGCAGGAGGTAGACCAGATCAAGTTTATAAG
TTTGTTCAAAGTGGAATAGTTCAAGCTTTATGTAGTTTACTTGAAGAAACTGATGTTAAG
ATTGTATCTGTTGCAATTGAAGGACTTAACCGCATATTAAGATGTGGAAAAGAAAACTTT
TCAACTGATGGAGGATCAAGTGAATTCGCTAATGTAGTTGAAGATTGCAATGGGCTATCA
AAACTAGAAAAATTACAACAACATCCAAATACTCAGATTTATGAAAAAGCTAGGAATATG
ATAGAAAACTATTTCCAGATTGAGCCTGATGAAAATGAGTCTTTGATACAGATGATTAAA
GGGTGCTCACAATTTAACCTCTAA