Identifiers and Description

Gene Model Identifier

SteCoe_15585

Standard Name

None

Aliases

None

Description

MutS_III domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000034216.47023492564546e-26
Saccharomyces CerevisiaeYDL154W1.7587922024243116e-25Protein of the MutS family; fo
rms a dimer with Msh4p that fa
cilitates crossovers between h
omologs during meiosis; msh5-Y
823H mutation confers toleranc
e to DNA alkylating agents; ho
mologs present in C. elegans a
nd humans
Oxytricha TrifallaxContig18281.0.g801.4251640827409352e-21MutS domain V

Tetrahymena ThermophilaTTHERM_002959204.248354255291589e-18MutS domain III family protein
; homolog to human MSH2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15585(Protein)
MSEIFISLKHDSKKLYLAKYSTDHGKIELSSLFMPVFNKPSIEHLIFLHSPTLIIVSAGI
SETIKKLSEDIKTVVVPISEFAYDICKDLIIKKCFSGNEFLAITSLDFSCKEFISCCGAL
VKFLESSHMKVYEIKYINAFCMGVDFKTLQCLQIIKEDPHPSLIKGSGRSKEGFSMLALM
DNTCTPQGKRKLKELLLQPFRYKDDIEDRLDSITYLISNPSLVLDLCNTLRSFSDLEIIL
KKYKENRETASDWIKLLSSLKSFLQVQERLENYPNSILILESIAKIDSYHIVNIIKVLEN
CLILEKDRPHVQRGVNEELDYYQKTYEEVEKFLQQLIEIEKKELTSLKYSNLTILYLHGF
GYVVEILFKESDFPEKFEAENYSFQFATEDCLYFKTLRTAVLDEKFGDLENKIRDAENSI
IIRIEEQIISQDETFSLISQSIATLDSLLSITQFAENFKLVRPIISETTNIQVVNGRHLL
VEICVDNFIPNDCALDFEHRIGVITGPNFSGKSVYLKTIGLIVYLSHIGCYVPAEYAEIG
VFDQLFSRMHSSESHNISSFAEELTQLSIALNNCTEKSLILIDEFGKGTSPVDGICLFSS
LVAEIEEDFKVTVLLTTHFEEVFNYCMIKESNIVKFYTMQMAFSDDPVYLYKLIRGLPSE
SSGIICAKWAGIADDVIDRALEIKGNLKNGDFDALNFARGIWEKVFEILKEFEEGEDCEE
VFDKLIEIIKS


>SteCoe_15585(CDS)
ATGTCAGAAATTTTTATCAGTCTCAAACACGACTCCAAAAAACTCTATCTAGCAAAATAC
TCAACAGACCATGGTAAAATAGAACTTAGTTCTTTATTCATGCCAGTTTTCAATAAACCA
TCAATAGAGCATCTAATATTTTTGCATTCTCCAACTCTTATAATAGTATCAGCTGGGATA
TCTGAAACAATAAAAAAACTAAGTGAAGATATAAAAACAGTAGTTGTTCCTATATCTGAA
TTTGCATATGATATATGTAAAGATCTTATAATAAAAAAGTGTTTTTCTGGGAATGAGTTT
TTAGCTATAACATCTTTAGATTTCTCTTGTAAGGAATTTATAAGTTGCTGTGGGGCTCTT
GTTAAGTTTTTAGAAAGTTCTCATATGAAAGTATATGAGATAAAATATATAAATGCATTT
TGTATGGGAGTGGATTTTAAGACTTTACAATGTTTACAGATTATTAAAGAAGACCCACAT
CCCAGTTTGATTAAAGGGAGTGGAAGGTCAAAAGAAGGATTTTCTATGTTAGCACTTATG
GATAACACATGTACTCCACAAGGGAAAAGAAAGTTAAAAGAATTATTGTTACAACCTTTT
AGATATAAAGATGATATTGAAGATCGACTTGATTCTATAACATATTTAATCTCAAATCCT
AGTCTTGTACTTGATCTTTGTAACACACTAAGATCTTTTAGTGATTTGGAAATTATACTT
AAAAAATATAAAGAAAATAGGGAAACCGCATCGGATTGGATTAAATTGTTAAGTTCGCTT
AAATCGTTTTTGCAGGTTCAAGAAAGACTTGAAAATTATCCTAATTCTATACTTATCCTT
GAATCGATAGCTAAAATTGATTCTTATCATATTGTTAATATTATAAAAGTTCTTGAAAAT
TGTTTGATATTAGAAAAGGATCGGCCACATGTTCAGCGTGGAGTTAATGAAGAACTGGAT
TATTATCAGAAAACATATGAGGAAGTGGAGAAGTTTTTACAACAGCTTATTGAAATTGAG
AAAAAGGAACTGACTAGTTTGAAATACTCTAATTTGACGATATTGTATTTGCATGGGTTT
GGGTATGTTGTCGAGATATTATTTAAAGAATCCGACTTCCCAGAGAAATTCGAAGCTGAA
AACTACAGTTTCCAATTCGCTACTGAAGATTGTCTTTACTTCAAAACCCTACGAACTGCA
GTCCTTGATGAAAAATTTGGTGACCTAGAGAACAAAATCCGTGATGCAGAAAACTCTATA
ATAATCCGTATAGAAGAACAAATAATCTCCCAAGATGAAACTTTTTCTCTAATTTCTCAA
TCCATAGCAACCTTAGACTCATTATTATCAATAACCCAATTCGCTGAAAATTTCAAACTT
GTTCGCCCAATAATATCAGAAACTACAAATATCCAAGTTGTTAATGGTAGACATCTTCTT
GTTGAAATTTGTGTCGATAATTTCATACCAAATGACTGCGCTTTAGACTTTGAACATCGT
ATCGGGGTAATAACTGGGCCTAATTTCTCAGGTAAAAGTGTTTATTTAAAAACAATAGGA
TTAATTGTATACCTTTCACATATTGGGTGTTATGTTCCAGCTGAATATGCTGAAATCGGG
GTTTTTGATCAACTTTTTTCAAGAATGCATTCTAGTGAAAGTCATAATATAAGTTCATTT
GCTGAAGAATTAACCCAATTGTCTATAGCTTTGAATAATTGTACAGAAAAATCACTTATA
CTTATTGATGAGTTTGGGAAAGGAACAAGTCCTGTTGATGGAATTTGTTTGTTTTCATCA
CTTGTTGCTGAGATTGAAGAGGATTTTAAAGTAACAGTTTTATTGACGACACATTTTGAA
GAAGTTTTTAATTATTGTATGATAAAAGAATCAAATATTGTGAAGTTTTATACTATGCAA
ATGGCTTTTAGTGATGATCCTGTGTATTTGTATAAACTTATAAGAGGATTACCAAGTGAA
AGTTCTGGGATTATATGTGCTAAATGGGCTGGGATTGCTGATGATGTTATTGATAGAGCT
TTGGAGATTAAAGGGAATTTGAAAAATGGAGATTTTGATGCTTTGAATTTTGCTAGAGGG
ATTTGGGAAAAAGTTTTTGAAATACTTAAGGAGTTTGAGGAAGGTGAGGATTGTGAGGAG
GTTTTTGATAAACTTATTGAGATTATTAAGAGTTAG