Identifiers and Description

Gene Model Identifier

SteCoe_15598

Standard Name

None

Aliases

None

Description

ALG11_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000151622.2273635617957438e-39
Tetrahymena ThermophilaTTHERM_006662206.054601895401186e-39Alpha-1,2-mannosyltransferase,
catalyzes addition of the ter
minal alpha 1,2-Man to the Man
5GlcNAc2-PP-dolichol in
termed
iate during asparagine-linked
glycosylation in the ER
Saccharomyces CerevisiaeYNL048W7.984904245686979e-30Alpha-1,2-mannosyltransferase;
catalyzes sequential addition
of the two terminal alpha 1,2
-mannose residues to the Man5G
lcNAc2-PP-dolichol intermediat
e during asparagine-linked gly
cosylation in the ER
Oxytricha TrifallaxContig20481.0.0.g50.00000000000003442477108469977Glycosyl transferases group 1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15598(Protein)
MLCNLLLYLFLTIFIYFFYFIIRTRISRSPKSIGFLHPYCNSGGGGERVLWTSIKALLSE
TSSYRIFIYSKDTEDLAQILEKVYKVFGIQISSTNLQLIHLTKVKYIEAKKYPIGTLFFQ
FLGSIILMHEILSKRPPSLLIDTHGQPFGYFLAKFSGIQVIAYVHYPLISTDMIEKVREM
RPSYNNSERISNNARISKVKLFYYKALMKWYQSVGLFCDLALCNSSWTIGHIKSTWRAKS
KVLYPPCDVNGFLKLPLELSKKKNVAISIGQFRPEKDHSLQILAFSELVKKYPNLQGELY
LVGSCRDNEDLKRVEMLKALAEEKGLKDLVRFYVNIDYLALMDLVKCAKVGLHSMWNEHF
GICVVELMASGLVTIAHNSAGPKQDIINHEINGFLAWSIEEYAFYIHKAFTQFEELWDLR
KNAREKSTTFSEEVFCAGFISEMRAFL


>SteCoe_15598(CDS)
ATGCTTTGCAACCTGCTTTTGTATCTCTTTTTGACTATATTCATCTACTTTTTCTACTTT
ATTATTCGAACTCGTATATCCCGTAGCCCTAAATCTATAGGATTCTTACACCCATACTGC
AACAGCGGTGGTGGTGGTGAAAGGGTTCTCTGGACATCAATCAAAGCTTTATTATCAGAA
ACCTCATCATATCGTATTTTTATATATTCTAAAGATACAGAAGATCTAGCTCAAATCCTA
GAAAAAGTTTATAAAGTCTTTGGAATCCAAATCTCTTCAACAAATCTTCAACTTATTCAT
TTAACTAAAGTTAAGTATATTGAAGCTAAAAAATACCCTATAGGTACATTATTTTTTCAA
TTCTTAGGGTCAATAATCCTCATGCATGAAATACTTAGCAAACGTCCTCCAAGTCTGCTT
ATTGACACCCATGGTCAACCTTTTGGGTATTTTTTAGCTAAGTTTTCTGGAATTCAAGTT
ATAGCTTATGTGCATTATCCTTTAATTTCAACTGATATGATAGAAAAAGTTAGGGAAATG
AGACCTAGTTATAATAACTCAGAACGTATATCTAATAATGCAAGAATAAGCAAAGTAAAG
CTTTTTTATTATAAGGCTTTAATGAAATGGTATCAATCTGTTGGCTTATTTTGTGATCTC
GCTTTATGTAATTCTTCATGGACTATTGGGCATATAAAATCAACATGGAGAGCTAAAAGT
AAAGTTTTATATCCACCATGTGATGTGAATGGGTTTTTAAAACTCCCTCTTGAGTTAAGC
AAAAAAAAAAATGTGGCGATTTCAATTGGGCAATTTAGACCTGAAAAAGACCATAGTTTA
CAGATTCTTGCTTTTAGTGAACTTGTTAAAAAATACCCAAATTTACAAGGAGAATTGTAT
TTGGTTGGATCTTGTAGGGATAATGAAGATTTAAAACGTGTTGAAATGCTTAAAGCTTTA
GCTGAAGAAAAAGGTTTGAAGGATTTGGTACGTTTTTATGTGAATATTGATTATTTAGCT
TTGATGGATTTGGTGAAATGTGCTAAAGTTGGCTTGCATTCTATGTGGAATGAGCATTTT
GGTATTTGTGTTGTAGAACTTATGGCTAGTGGACTTGTGACTATAGCCCATAATTCTGCT
GGACCGAAACAAGATATAATCAATCATGAAATTAATGGGTTTTTAGCTTGGAGTATAGAA
GAATATGCTTTTTATATCCACAAAGCGTTTACACAGTTTGAAGAACTTTGGGATTTGAGA
AAAAACGCTAGGGAAAAATCGACAACTTTTTCTGAGGAAGTTTTCTGTGCAGGGTTCATC
TCAGAAATGCGGGCTTTTTTGTAG