Identifiers and Description

Gene Model Identifier

SteCoe_15774

Standard Name

None

Aliases

None

Description

SMC_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000048732.4069765506104637e-69
Saccharomyces CerevisiaeYJL074C2.3455513385429143e-59Subunit of the multiprotein co
hesin complex; required for si
ster chromatid cohesion in mit
otic cells; also required, wit
h Rec8p, for cohesion and reco
mbination during meiosis; phyl
ogenetically conserved SMC chr
omosomal ATPase family member
Oxytricha TrifallaxContig17078.0.g585.665668176358939e-52RecF/RecN/SMC N terminal domai
n

Tetrahymena ThermophilaTTHERM_008129500.00000000003775134544279098SMC family, C-terminal domain
containing protein, condensin
subunit, required for division
of MIC and MAC.

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15774(Protein)
MHIKQIIIRGFKTYREQVIIGPLSAKDNVFVGQNGHGKSNFFSAIMFVLSDKFSNIRQEE
KQRLIHEGAGEASNSACVEIILDNSDSRLPIDKSTVSIKRILEDKKDEFYIDNKHVTKAD
INNLLESAGFSKSNPYYVVQQGRVASLAGMNESQCLDLLKEVAGTIVYDERKTESEKLID
ETKRKTEKIQELMDRIREKIKELQGESAELQDYTKLEKERRAMEYILYKNHVVSAQEMID
SIEATQADLLEKVNNLKLTHNNFQEEIDTYEAFIDSKNILIGKFAGALENLGQEMGKLQS
EKVKVESKLSVYKEQRKKITEDLALNQNEHKKVLQDLQKTEILLQAQRPEYQKIAFEENK
AYDLLKIKKRRKNELFTKQGSVSKFKNLKDRNKFLNSELKKLEDFRNELKGQMDKVAGEI
NNARKELNDITSKLPIVTNKCYEEKKYNENLSEEIMNIKQLRSANVTQLATLRHKEEGLV
XSANVTQLATLRHKEEGLVSQKEQTDSKINQNTQKLRILLAGTLFSTLEKLKNECKNLSG
FYGLLIDLIIIPTKFQTCADIVAKTKVFSIIVDTFNTAKKVLDINTRIGGDRITIYPIEW
IDEIDSKERNYPTGSDSIALIKQIKLREGVNPEIIRFVNFIFGKTLLVRNQEVANRYAKD
FKLHCVTPDGLMVHAGAYRMRAGFHDLKRERIRTYNEFSTFQSEMNTVQQSLLDIIKEKD
YYLNQDSEFVRKMQEISNEKDKSNGRIQELKTLEANMKSSKIEIVKSITEMERAMEQYNK
EISAVEDTIAATKVELSKTDIGELSKNEAHELEMLIKEVQDLENQYKVLSTQKNNAESEI
QHLEQQLNHYLPENERRLEELISDCLVALESRDESDIQEDCKQVTKQIESCEINIHRTSQ
DLVDINGQVREYEDKIKSLKENQQRLNQEVSELQTEIERTTLKLMNSMESKENYIKKMGA
LGSLPAEEHEKFKGENPQTLMRLLEDNSSSIKKYQHVNKRALEQYNKYTEKLEGLNEKIS
DLEKSDKSIKDLLSHLEKVKDEAIIRTFRSVAQHFSEVFHEIVPQGKGRLKMVKGDGTGV
EKYVGVSISVSFSRSEDAVYKMQQLSGGQKTAVAIALIVAIQRADPAPFYLFDELDAALD
SQLRNSLAAVITRSAEKAQFIMTTFKPELCKNSAKIFEVRFKNKASTIRQIDKTRALEVI
QQIDPSN


>SteCoe_15774(CDS)
ATGCACATCAAGCAAATTATCATTAGAGGTTTCAAAACCTATCGAGAGCAAGTGATTATT
GGTCCATTAAGTGCAAAGGACAATGTTTTTGTAGGTCAAAATGGTCATGGCAAATCAAAT
TTTTTCAGTGCGATCATGTTTGTTTTATCAGATAAGTTTTCCAACATAAGACAAGAAGAA
AAACAAAGACTAATACATGAAGGTGCAGGTGAGGCTAGTAATTCAGCTTGTGTCGAGATT
ATTTTAGATAATTCAGACTCCCGCCTTCCTATTGATAAGTCGACTGTATCTATAAAACGT
ATTTTAGAAGATAAAAAAGATGAGTTTTACATTGACAATAAACATGTGACAAAAGCAGAT
ATAAACAATCTTCTAGAAAGTGCAGGTTTTTCTAAGTCCAATCCATATTATGTTGTCCAA
CAAGGTAGAGTTGCTTCTTTAGCCGGGATGAATGAATCTCAATGTTTAGACCTATTAAAA
GAAGTTGCAGGTACAATAGTTTATGACGAACGCAAAACTGAAAGTGAAAAACTCATCGAT
GAAACCAAAAGGAAAACTGAAAAAATCCAAGAACTCATGGACAGAATCAGAGAAAAAATC
AAAGAATTACAAGGAGAAAGTGCAGAACTTCAAGATTATACAAAACTAGAAAAAGAAAGA
AGGGCAATGGAATATATTTTATACAAAAACCATGTTGTAAGCGCTCAAGAAATGATTGAC
TCAATTGAAGCAACACAAGCTGATCTTCTTGAAAAAGTTAACAACTTAAAACTTACTCAT
AATAATTTCCAAGAAGAAATCGATACATATGAAGCTTTTATAGACTCAAAAAACATACTC
ATTGGGAAATTTGCCGGAGCTCTAGAAAATCTGGGACAGGAAATGGGAAAACTTCAAAGC
GAAAAAGTTAAAGTAGAATCGAAACTGTCGGTTTATAAGGAACAAAGGAAAAAAATAACT
GAAGATTTAGCTTTGAATCAAAATGAACATAAAAAAGTTCTTCAGGATTTGCAGAAGACT
GAGATTTTGTTACAAGCGCAAAGGCCTGAGTATCAGAAAATTGCTTTTGAAGAAAATAAA
GCGTATGATTTACTTAAAATAAAAAAACGCAGAAAAAACGAACTTTTTACTAAGCAAGGA
AGTGTTTCTAAGTTTAAAAATCTTAAGGATCGGAATAAATTCTTGAATTCGGAACTGAAA
AAACTTGAGGATTTTAGAAATGAACTTAAAGGACAAATGGATAAAGTTGCTGGGGAAATC
AATAATGCAAGAAAAGAACTTAATGATATAACTTCTAAGCTACCAATAGTGACAAATAAG
TGTTATGAGGAAAAAAAATACAATGAAAATTTATCAGAAGAAATTATGAATATAAAACAA
TTAAGATCAGCAAATGTGACACAACTTGCAACTTTAAGACATAAAGAAGAAGGTTTGGTT
NGATCAGCAAATGTGACACAACTTGCAACTTTAAGACATAAAGAAGAAGGTTTGGTTTCA
CAAAAAGAACAAACAGATTCTAAGATTAATCAAAATACACAAAAACTGAGGATTCTACTT
GCTGGGACACTTTTCAGCACATTAGAAAAACTAAAAAATGAATGTAAAAATCTTTCAGGT
TTTTACGGCCTTTTAATTGACCTTATAATCATCCCTACAAAATTCCAAACATGTGCTGAT
ATTGTAGCGAAAACTAAAGTTTTTTCTATAATTGTTGATACTTTTAATACTGCGAAAAAA
GTTCTTGATATTAATACACGTATAGGTGGAGATCGTATAACAATTTATCCTATTGAATGG
ATTGATGAAATTGATTCAAAAGAACGGAATTATCCTACAGGTTCAGATTCAATTGCTTTA
ATAAAACAAATCAAACTTCGCGAAGGTGTAAATCCTGAAATAATACGCTTTGTGAATTTT
ATATTTGGTAAAACACTTTTAGTACGTAATCAAGAAGTGGCAAATCGTTATGCAAAAGAT
TTTAAATTACATTGTGTTACACCTGATGGACTTATGGTTCATGCTGGTGCTTATCGTATG
AGAGCAGGCTTTCATGATTTAAAAAGAGAAAGGATAAGGACTTATAATGAATTTTCAACT
TTTCAAAGTGAGATGAATACTGTGCAGCAAAGTTTGCTAGATATTATTAAAGAAAAAGAT
TATTATTTGAATCAAGATTCAGAGTTTGTTAGAAAAATGCAGGAAATCAGTAATGAAAAA
GATAAAAGCAATGGTAGGATACAGGAGTTGAAAACCTTAGAAGCAAATATGAAGTCTTCA
AAAATTGAGATTGTAAAAAGCATTACAGAAATGGAAAGGGCTATGGAGCAATACAACAAA
GAAATATCAGCAGTAGAAGATACAATTGCCGCAACTAAAGTGGAACTAAGCAAGACTGAT
ATTGGTGAACTAAGTAAAAATGAAGCTCATGAGTTAGAAATGCTTATAAAAGAAGTACAA
GATTTAGAAAACCAGTACAAGGTATTATCGACACAAAAAAATAACGCTGAAAGCGAAATA
CAACATCTTGAACAACAATTAAACCATTATCTTCCAGAAAATGAAAGAAGACTTGAAGAA
CTTATAAGTGATTGTTTAGTTGCATTAGAATCTAGAGATGAATCTGATATTCAAGAAGAC
TGCAAGCAAGTAACAAAGCAAATTGAAAGCTGTGAAATAAATATACATAGAACAAGTCAA
GATTTAGTAGATATAAATGGGCAAGTTCGTGAATATGAAGATAAAATCAAGTCACTTAAA
GAAAACCAACAACGTTTAAATCAAGAAGTTAGTGAACTGCAGACTGAGATTGAAAGGACT
ACTTTAAAACTCATGAACTCAATGGAAAGTAAAGAAAACTATATTAAAAAAATGGGAGCT
CTAGGCTCCCTTCCAGCTGAAGAGCATGAGAAATTCAAAGGAGAAAACCCTCAAACTTTA
ATGAGACTTCTAGAAGACAACTCATCTAGTATAAAAAAATACCAGCATGTAAACAAAAGA
GCCCTTGAGCAATACAATAAATACACAGAAAAACTAGAAGGCCTTAATGAGAAAATTTCT
GATCTCGAGAAATCAGACAAATCCATCAAAGACCTCCTTTCACATCTAGAAAAAGTTAAA
GATGAAGCTATAATCCGTACTTTCCGTAGTGTAGCCCAGCACTTTTCTGAAGTCTTTCAT
GAAATCGTCCCTCAAGGCAAAGGTCGTTTAAAAATGGTCAAAGGTGATGGTACTGGTGTA
GAAAAATATGTTGGTGTAAGTATATCCGTATCTTTTTCCCGAAGTGAAGATGCTGTTTAT
AAAATGCAACAATTATCAGGAGGTCAAAAAACAGCAGTAGCTATAGCTCTAATAGTTGCC
ATACAAAGAGCAGACCCAGCTCCATTTTACTTATTTGATGAATTAGATGCAGCTTTAGAT
TCCCAACTTCGTAACTCATTAGCTGCTGTAATAACTCGTTCTGCAGAAAAAGCTCAGTTT
ATAATGACTACATTCAAACCAGAGCTCTGTAAAAACTCAGCTAAAATCTTTGAAGTACGT
TTTAAAAATAAAGCAAGCACAATACGTCAAATAGATAAAACTAGAGCATTAGAAGTTATA
CAACAAATTGACCCATCTAATTAA