Identifiers and Description

Gene Model Identifier

SteCoe_15873

Standard Name

None

Aliases

None

Description

SNF2_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14905.0.g135.814040485895939e-62SNF2 family N-terminal domain

Tetrahymena ThermophilaTTHERM_010805005.166420632837861e-55Helicase conserved C-terminal
domain containing protein
WormBaseWBGene000158065.5210822770285325e-42
Saccharomyces CerevisiaeYBR245C3.1391327920480296e-17ATPase subunit of imitation-sw
itch (ISWI) class chromatin re
modelers; with Ioc3p forms Isw
1a complex involved in repress
ion of transcription initiatio
n; with Ioc2p and Ioc4p forms
Isw1b complex involved in regu
lation of transcription elonga
tion; Isw1b recruited to ORFs
by H3K36 methylation and acts
with Chd1p to prevent trans-hi
stone exchange over coding reg
ions; Isw1p import into nucleu
s depends on C-terminal bipart
ite nuclear targeting signal K
RIR X19 KKAK

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15873(Protein)
MEDDPLKHSVNDSSFKKNEEPSKESEELKINREKALLRKQQFQQRMSKTPPLKIESGDQL
DDIPYDKYKNPLRQYFEGKITISLDIYDRDRFRVKGVSIPEDIIQTIDSFGGKLLNESNS
WTVPLSNYYRFRAEIYRRSTAEINDIPRFVILLMQNPNSSMKTNYTKQYEKVPSLESLPY
ELKTKMYPFQRDGVRFVISKHGRALIGDEMGVGKTVQAIASAFLYFEEWPVLVICPASLK
FNWRDEFMKWLPQLKRNHFFIVESGRKPPVDAKVWIISYTIATSQQTLMSAHNFKVIIAD
ECHYLKSYTAQRTKAIIPILQASRRVILLSGTPMISRPAEIYNILTALRPDIFRSYFEFA
NRYCGPKKMLSHTDFSGISNAKELYSILNSCLMIRRLKSDVLSELPAKIRQKVEIPAEAQ
QCKAIRKIYSDVSTSKTNSFPLLEGNQFINQAYLLTCQAKIVGVCDYINYLLECECKFIV
FAHHLEMMNAIQEKVEGGKVKFIRIDGKTQAEKRQDLVNEFQSNKDCKVAILSILAAGVG
ITLTAASLVVIAEMAWSPSVMVQAEDRAHRVGQTKSVNIHYLFGPATLDEYIWPKIQAKL
SVISKALDNDCNPENYSLFNPECKLGFGDFDTEDLFKEIKHFNAFS


>SteCoe_15873(CDS)
ATGGAAGATGACCCCCTTAAGCATAGTGTGAATGATTCGAGCTTTAAGAAGAATGAAGAA
CCTTCAAAAGAGAGTGAAGAACTTAAAATAAATAGAGAAAAAGCTTTATTGAGAAAGCAG
CAATTTCAACAAAGAATGTCTAAAACCCCTCCTCTAAAAATTGAATCTGGTGATCAATTA
GATGATATCCCTTATGATAAATATAAAAATCCTCTAAGACAATATTTTGAAGGAAAAATA
ACTATATCACTTGATATTTATGATAGGGACAGATTTAGAGTTAAAGGCGTAAGCATTCCG
GAAGATATTATTCAAACTATTGATAGTTTTGGGGGGAAACTATTAAATGAAAGTAACTCA
TGGACTGTGCCACTCTCTAATTACTATCGATTTAGAGCTGAAATTTACAGAAGATCAACT
GCAGAAATTAATGATATCCCAAGATTTGTAATTCTTCTAATGCAAAACCCAAATTCATCT
ATGAAGACAAACTATACCAAGCAATATGAAAAAGTGCCATCGCTTGAATCTCTTCCTTAT
GAGTTAAAAACAAAAATGTATCCTTTTCAAAGAGATGGTGTAAGATTTGTTATATCAAAG
CATGGTAGAGCATTAATAGGTGATGAGATGGGTGTGGGTAAAACAGTCCAAGCTATAGCC
TCAGCTTTTTTGTATTTCGAAGAATGGCCGGTTCTTGTCATCTGTCCCGCTTCTTTAAAA
TTTAACTGGCGAGACGAGTTTATGAAATGGCTTCCTCAATTGAAAAGAAATCATTTCTTC
ATAGTTGAGTCAGGAAGAAAGCCTCCTGTTGATGCAAAAGTTTGGATAATCTCCTATACA
ATAGCAACTTCTCAACAAACTCTAATGTCAGCCCATAACTTTAAAGTAATCATTGCTGAT
GAGTGTCATTATCTTAAAAGCTATACAGCCCAACGAACAAAAGCTATAATTCCAATTCTA
CAAGCCAGTCGTCGAGTTATCCTTTTAAGTGGTACCCCCATGATATCACGTCCTGCTGAG
ATATACAACATCCTAACAGCCTTACGTCCTGATATTTTCCGAAGTTATTTCGAGTTCGCC
AATCGTTACTGTGGACCTAAAAAAATGCTTAGTCATACTGACTTCTCAGGTATTTCCAAT
GCTAAAGAATTGTATTCAATACTCAATAGTTGCCTTATGATAAGAAGACTCAAAAGTGAT
GTTCTAAGCGAGCTCCCTGCGAAAATCAGACAGAAAGTTGAGATCCCGGCTGAAGCCCAG
CAATGCAAAGCTATAAGGAAAATCTACTCAGATGTCTCGACATCAAAAACAAATTCATTC
CCATTACTTGAAGGTAATCAATTCATTAATCAAGCATATCTATTAACTTGTCAAGCTAAA
ATTGTAGGGGTTTGCGATTATATAAATTATTTATTAGAATGTGAATGTAAGTTTATAGTA
TTTGCCCATCATCTAGAAATGATGAATGCGATTCAAGAAAAAGTTGAAGGAGGAAAAGTT
AAGTTTATAAGAATTGATGGGAAGACTCAAGCTGAGAAAAGGCAGGATCTAGTGAATGAG
TTTCAATCAAATAAAGACTGTAAAGTTGCTATTTTGAGTATTTTAGCGGCTGGGGTTGGG
ATAACTTTGACTGCAGCTTCCCTTGTTGTTATAGCTGAAATGGCTTGGTCACCTAGTGTT
ATGGTTCAAGCTGAAGATCGAGCTCATCGTGTTGGTCAGACAAAATCAGTTAATATCCAT
TATCTTTTTGGACCTGCTACGTTAGATGAATATATTTGGCCGAAAATACAAGCTAAGCTT
TCAGTGATTTCTAAAGCTCTGGATAATGATTGCAATCCAGAAAATTACAGTTTGTTTAAC
CCTGAATGCAAGCTTGGTTTTGGAGATTTTGATACTGAAGATTTGTTTAAGGAAATCAAG
CATTTCAATGCATTCTCGTAA