Identifiers and Description

Gene Model Identifier

SteCoe_15909

Standard Name

None

Aliases

None

Description

PMSR domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • peptide-methionine (S)-S-oxide reductase activity (IEA) | GO:0008113

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_012891400.000000000000001713908431542013Peptide methionine sulfoxide r
eductase family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15909(Protein)
MYLIIFISIVSGTFCVYNERALILNSYLSEKFEKNSDRTCPSCKQDCDLLRTTISTLPNL
EEAMLGRQEKMQFNTTHYLLQTPIVEPFPKHLEVSIVAMGCFWGVEKLFWKEKGVISTAV
GYVAGFTPNPNYEEAYTGQTGHAEAVKIVFDPRVTSFRKILKLFWENHDPTQGMRQGEDF
GTQYRSMILAMTPEQREEAIMSRNLFQKELYKLGMGTITTQITPAFEFYYAEDYHQQYLA
KRPGGYCGIAGTGAYLPKSFE


>SteCoe_15909(CDS)
ATGTATTTAATCATATTTATCTCTATAGTCTCAGGAACATTCTGTGTTTACAACGAAAGG
GCTCTTATCTTAAACTCCTACCTTTCAGAAAAATTCGAAAAAAATAGTGATCGAACCTGC
CCATCATGTAAACAAGACTGTGACCTTCTTCGAACAACCATAAGCACTTTACCAAACCTT
GAAGAAGCAATGCTCGGACGTCAAGAAAAGATGCAATTCAATACAACTCATTATTTACTT
CAAACACCAATAGTCGAACCTTTTCCTAAGCATTTAGAAGTATCAATAGTAGCAATGGGC
TGTTTCTGGGGAGTGGAGAAGCTATTTTGGAAAGAAAAAGGGGTGATTTCTACAGCAGTT
GGATATGTGGCTGGATTTACTCCTAATCCAAACTATGAAGAAGCATATACTGGACAAACA
GGCCATGCTGAAGCTGTGAAAATTGTTTTTGATCCTAGAGTGACTTCTTTTAGAAAAATC
CTCAAATTATTCTGGGAAAACCATGACCCGACACAAGGCATGAGACAGGGAGAAGACTTT
GGTACGCAATATAGGTCGATGATATTAGCAATGACCCCAGAACAAAGAGAAGAGGCAATT
ATGAGCAGGAATTTGTTTCAAAAAGAACTTTATAAATTGGGAATGGGGACAATTACTACA
CAGATCACACCTGCGTTTGAGTTTTATTATGCTGAAGACTATCATCAACAGTATCTAGCT
AAGCGGCCTGGAGGGTATTGCGGTATTGCTGGTACAGGTGCTTATCTTCCAAAATCATTT
GAATAA