Identifiers and Description

Gene Model Identifier

SteCoe_15965

Standard Name

None

Aliases

None

Description

UQ_con domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005507201.8048513878454153e-35E2 ubiquitin-conjugating enzym
e
WormBaseWBGene000067011.3336148155022614e-34
Saccharomyces CerevisiaeYGL058W3.975449735908647e-31Ubiquitin-conjugating enzyme (
E2); involved in postreplicati
on repair as a heterodimer wit
h Rad18p, DSBR and checkpoint
control as a heterodimer with
Bre1p, ubiquitin-mediated N-en
d rule protein degradation as
a heterodimer with Ubr1p, as w
ell as endoplasmic reticulum-a
ssociated protein degradation
(ERAD) with Ubr1p in the absen
ce of canonical ER membrane li
gases
Oxytricha TrifallaxContig16539.0.g1153.975449735908647e-31Ubiquitin-conjugating enzyme

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_15965(Protein)
MTTPARRRLMRDLKKLQSDKVDGISAAPSNDNIMLWNAVIFGPEDTPWEGGTFRLTVEFS
EEFPNKAPAVKFLTRMFHPNSMQYAVYNDGTICLDILQNQWSPIYDVQAILTSIQSLLCD
PNPNSPANSEAARIYNENTREYNRRVREVVEDSWCNS


>SteCoe_15965(CDS)
ATGACTACACCTGCAAGAAGAAGGCTTATGAGGGATTTAAAAAAACTTCAGTCTGATAAA
GTTGATGGGATTTCTGCTGCACCGAGCAATGACAACATAATGCTATGGAACGCGGTTATT
TTTGGTCCAGAAGATACCCCTTGGGAAGGGGGAACTTTTCGCCTTACTGTTGAGTTCTCA
GAAGAATTCCCTAACAAAGCTCCAGCTGTAAAATTTCTTACCAGAATGTTTCATCCAAAC
AGTATGCAATATGCAGTTTATAACGATGGGACTATTTGTCTTGATATTCTTCAGAATCAA
TGGTCTCCGATTTATGATGTTCAAGCAATTTTGACATCAATTCAAAGTCTTTTATGCGAT
CCTAATCCAAACTCCCCAGCAAACAGTGAAGCTGCTCGTATATACAACGAAAACACTCGT
GAATATAACAGAAGAGTACGGGAAGTGGTTGAAGACTCCTGGTGCAATAGTTAA