Identifiers and Description

Gene Model Identifier

SteCoe_160

Standard Name

None

Aliases

None

Description

eIF2A domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000012254.780892883885469e-25
Saccharomyces CerevisiaeYOR361C9.602680054508676e-24eIF3b subunit of the eukaryoti
c translation initiation facto
r 3 (eIF3); subunit of the cor
e complex of eIF3; essential f
or translation; part of a subc
omplex (Prt1p-Rpg1p-Nip1p) tha
t stimulates binding of mRNA a
nd tRNA(i)Met to ribosomes
Tetrahymena ThermophilaTTHERM_004431005.74952226429356e-19RNA recognition motif-containi
ng protein
Oxytricha TrifallaxContig19782.0.g585.74952226429356e-19Eukaryotic translation initiat
ion factor eIF2A

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_160(Protein)
MEDKQPLTSFSHLKNQIFLIDFTDEISSDPELSQYIDKELQLVKESSEPLVEPWPIFEMQ
WTNRVIVGGLPEVNEEKAQNLIKFLSRLSAKSNCPIEPSDIHMPMLKGMSLRFAIITFKD
DEIAKSAVINLNGVNLDKKHTLTVLSFDEFDRIMELPDTYQEPRIYSQQQLKSWLTDSLG
RDQFIIRAGEKTQVFWNDSLSRIPELVSNGPLGKVWTDKYIAWSSDGTYLATMHSRGVVI
WAGPEFEEMGKLEHYGVGQVGFSPCERYVLTFSAKGKFIVWNLSTKEEIRVFPAEEEKWG
TYKWSHNGDFLAKMAEESIFIYQTSSMSMLEDENGMKRPLKIEGLADFSWSPGANIIACY
IRENSNRPAIIKIISIPNKELIASRNLFDALACTFFWQSDGEYLLSLVRTINQDSHYITK
TIFEVTCLKIKNTPTLSLSLNASVISCAWQNGTNRFAVVAAHGKDNHKKFSVYEIDSKKN
IVLIGEKDTQITEILWAPQGNQVVLYSKDKYKLVFYSIGDKGISDLEERTYTNLNYLEWD
PSGRYLIVAKTVELKSNQSLMGTGYIIYNGQGEIVCQYLMEKFYQILWRPRPKFILPKEA
HTKLITEYEHLTKKYAEQDREIKKKSKQEKLRKENEKKIEFLALIQRNREIWIKTAEDRK
NLYGRSDEEERNRWSMEHNNVEEVINVTKERIREQVAS


>SteCoe_160(CDS)
ATGGAAGACAAACAGCCATTAACATCATTTTCACATCTAAAAAATCAGATTTTCCTAATC
GATTTCACCGATGAAATCTCATCAGACCCTGAACTCAGCCAATATATCGATAAAGAATTG
CAACTAGTCAAAGAAAGCAGTGAACCATTAGTTGAGCCTTGGCCAATATTTGAGATGCAA
TGGACAAATCGAGTAATTGTTGGAGGTTTGCCTGAAGTAAACGAAGAAAAAGCTCAGAAC
CTAATCAAATTCTTATCAAGACTCTCAGCAAAGTCTAATTGTCCAATCGAACCATCAGAT
ATTCACATGCCAATGCTTAAAGGTATGAGCTTACGTTTTGCAATTATAACTTTTAAAGAT
GATGAAATAGCGAAATCAGCAGTCATAAACCTAAATGGTGTTAATCTTGATAAAAAACAT
ACTTTAACTGTATTGTCTTTTGATGAATTCGATAGGATTATGGAACTTCCAGATACTTAT
CAAGAACCAAGAATCTATTCTCAACAACAACTCAAAAGTTGGCTTACAGACTCACTTGGC
CGAGATCAGTTTATTATAAGAGCTGGGGAAAAGACTCAAGTTTTTTGGAATGACTCATTA
TCTAGAATTCCAGAATTAGTTTCAAATGGTCCATTAGGGAAAGTATGGACAGATAAATAT
ATAGCTTGGAGTTCTGATGGAACTTATTTAGCAACAATGCATAGTAGAGGGGTTGTTATT
TGGGCTGGACCAGAATTTGAAGAGATGGGTAAATTGGAACATTATGGGGTTGGACAAGTT
GGGTTTTCGCCTTGTGAAAGATATGTGTTAACTTTTAGTGCTAAAGGTAAATTTATAGTG
TGGAATCTAAGTACTAAAGAAGAAATAAGGGTTTTTCCTGCTGAAGAAGAGAAATGGGGA
ACTTATAAATGGAGTCACAATGGAGATTTCTTAGCTAAAATGGCTGAAGAGAGTATTTTT
ATATATCAAACCTCTTCTATGTCCATGCTTGAAGATGAAAATGGAATGAAAAGACCTTTG
AAAATCGAAGGACTCGCCGACTTCTCATGGAGTCCTGGGGCTAATATCATAGCTTGTTAT
ATTAGAGAAAACAGTAATAGACCAGCTATAATAAAAATCATCAGCATTCCAAACAAAGAA
CTCATTGCTTCAAGAAACCTTTTCGATGCTTTAGCCTGTACATTTTTCTGGCAAAGTGAT
GGAGAGTATCTTTTATCTTTAGTTCGTACTATAAATCAAGATAGTCATTATATTACAAAA
ACAATATTTGAAGTGACTTGCCTTAAAATTAAAAATACACCTACTTTATCTTTATCACTT
AATGCTTCAGTTATAAGTTGTGCATGGCAAAATGGGACAAATAGATTTGCTGTTGTAGCG
GCTCATGGTAAGGATAATCATAAGAAATTTTCTGTTTATGAAATTGATTCAAAGAAAAAC
ATTGTGCTTATAGGGGAAAAAGATACACAGATTACAGAAATATTATGGGCTCCACAAGGA
AACCAAGTAGTTTTGTATTCAAAAGATAAGTATAAGCTTGTTTTTTATTCAATAGGAGAT
AAAGGGATTAGTGATTTAGAAGAAAGAACTTATACTAATTTGAACTATTTAGAATGGGAC
CCAAGTGGAAGGTATCTTATTGTTGCTAAAACTGTAGAACTTAAATCAAATCAATCACTT
ATGGGTACAGGATATATTATTTATAATGGTCAAGGAGAAATTGTATGTCAGTATCTTATG
GAAAAGTTTTATCAAATACTTTGGAGACCAAGACCTAAGTTTATTTTACCTAAAGAAGCA
CATACTAAACTTATAACTGAATATGAGCATTTGACTAAGAAATATGCTGAACAAGATAGG
GAAATAAAAAAGAAATCTAAACAAGAAAAGCTTAGAAAAGAAAATGAAAAGAAAATCGAA
TTTCTAGCTTTGATACAGAGGAATAGGGAGATTTGGATTAAAACTGCTGAAGATAGGAAA
AATTTATATGGAAGAAGTGATGAAGAAGAGAGAAATAGATGGAGTATGGAACATAATAAT
GTTGAAGAAGTTATTAATGTGACAAAAGAACGGATAAGAGAACAAGTAGCTAGTTAG