Identifiers and Description

Gene Model Identifier

SteCoe_16053

Standard Name

None

Aliases

None

Description

ATP_bind_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_008219103.221340285992516e-27GPN-loop GTPase
Saccharomyces CerevisiaeYOR262W6.47023492564546e-26Putative GTPase with a role in
biogenesis of RNA pol II and
polIII; may be involved in ass
embly of RNA polymerases II an
d III and in their transport i
nto the nucleus; contains a Gl
y-Pro-Asn motif in the G domai
n; similar to Npa3p and Gpn3p;
highly conserved across speci
es and homologous to human gen
e GPN2/ATPBD1B; required for e
stablishment of sister chromat
id cohesion
Oxytricha TrifallaxContig21267.0.g521.7587922024243116e-25Conserved hypothetical ATP bin
ding protein

WormBaseWBGene000150297.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16053(Protein)
MECILVIGPAGAGKSTFCKGFQEFLRSLGKDAKILNLDPANENLPYTADVDICELITLDD
VCESMNLGPNGGLLYCMDFIHTNITWLNNSLSSLGKSLLLIDCPGQIELFAQHPVLPKII
SELTNRLNCKSMALNIIDSNLCSNAHIFIASCLMSLSIMTHLELPHLNVLSKIDLLSHFH
KDLAFGLEFYTDISQLAKLISIEDQEFNPKLARMSEKIAEIIDDFGLVSFQLLCVDDKEL
MGSLTKQIARTLGTQVYYEEEFNDFSVSERIQSIEEKYLESQ


>SteCoe_16053(CDS)
ATGGAATGCATTCTTGTCATTGGTCCTGCAGGTGCAGGTAAAAGCACATTTTGCAAAGGT
TTCCAAGAATTTCTCAGAAGTCTAGGTAAAGACGCAAAAATCCTCAACCTCGACCCAGCA
AATGAAAATCTCCCTTACACAGCTGATGTTGATATATGTGAGCTTATAACTCTTGATGAT
GTTTGTGAGTCTATGAATTTAGGCCCAAATGGTGGGCTTTTATATTGTATGGATTTTATT
CATACCAACATAACCTGGCTTAACAATTCTTTATCATCCTTAGGTAAATCTCTTCTTCTT
ATTGATTGCCCAGGTCAAATAGAGTTATTTGCCCAACACCCAGTTCTCCCTAAAATCATT
TCAGAACTCACAAATAGACTCAATTGTAAATCTATGGCTTTGAATATTATCGACAGCAAC
CTATGCTCAAATGCTCATATTTTTATTGCATCATGCTTGATGTCTCTTAGTATTATGACC
CATTTAGAGCTTCCACATTTGAATGTTTTATCAAAAATCGACTTACTTAGTCATTTTCAT
AAAGATTTAGCTTTTGGTTTAGAGTTTTATACTGATATAAGCCAACTTGCAAAATTGATA
TCGATTGAAGATCAAGAATTTAACCCTAAACTTGCTAGAATGAGCGAGAAAATAGCTGAG
ATTATTGATGATTTTGGTTTAGTTTCATTTCAGTTGTTATGTGTTGATGATAAAGAACTT
ATGGGATCTTTGACTAAACAGATTGCAAGAACGCTTGGGACACAGGTGTATTATGAGGAA
GAATTTAATGATTTTTCAGTTTCGGAAAGGATTCAGTCTATAGAAGAAAAATATTTAGAG
AGTCAATGA