Identifiers and Description

Gene Model Identifier

SteCoe_16075

Standard Name

None

Aliases

None

Description

NEK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig6412.0.g994.7111658015535965e-58Protein kinase domain

Tetrahymena ThermophilaTTHERM_005297802.572209372642415e-56NIMA-Related Kinase
WormBaseWBGene000226316.47023492564546e-26
Saccharomyces CerevisiaeYDR507C3.1391327920480296e-17Protein kinase involved in bud
growth and assembly of the se
ptin ring; proposed to have ki
nase-dependent and kinase-inde
pendent activities; undergoes
autophosphorylation; similar t
o Hsl1p; GIN4 has a paralog, K
CC4, that arose from the whole
genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16075(Protein)
MSDKYKMLKLLGEGSYGKCYLVEAQSDKVRCVIKQIDISQMTPSEKDDTIRESLILRNLN
HPNIIKFRDAYTTKKKKLCIVMDYADGGDMQSKIKERNGRIFSEDQVLDWFVQICLAMKH
VHDRKILHRDLKSQNIFLTKTGRIKLGDFGIAKILRTTMDNAQTMVGTPYYLSPEIVENR
PYNFKSDVWALGVLVYEIACLKPPFDASSLHSLALKIVRGQFQPMPKQFSQPLRNLVSKM
LKTDPALRPTVHEILKEPIIRDRIKNFLSSSQRNNEFSHTIMHNFRIVDETEKAREDLSI
MSNPEEEKKQEEIKKEMLKSVRQLKNEFKNMKDLDKEEQEEKIMLCEMNEIVLSCEDDVT
EVSVHNSIVEVPPDRDDEIDDSHENDISSNPEGKIKLMKEYLTKILGKKKLSEAKKIINA
LVPTEDDLDFDMLSPHLEHILDQNQQGEYVPIIYSLIELERSIS


>SteCoe_16075(CDS)
ATGTCAGACAAGTACAAAATGCTAAAACTTCTTGGCGAAGGGTCATACGGCAAATGCTAC
CTAGTCGAAGCTCAATCCGACAAGGTTCGCTGTGTTATCAAACAAATTGATATCAGCCAA
ATGACCCCATCAGAAAAAGACGATACTATTCGTGAATCCCTAATCCTAAGAAATCTAAAC
CATCCGAACATAATAAAATTCCGTGATGCATATACAACGAAAAAAAAGAAACTTTGTATA
GTCATGGACTATGCAGATGGTGGGGATATGCAATCTAAAATCAAAGAACGTAATGGGCGA
ATATTTTCTGAAGACCAAGTTTTAGATTGGTTTGTACAAATCTGTTTAGCAATGAAACAT
GTACATGATAGAAAAATTTTACATAGAGACTTGAAATCTCAAAATATATTCCTAACAAAG
ACTGGAAGAATCAAATTAGGGGATTTTGGTATAGCTAAAATCCTAAGAACAACAATGGAT
AATGCTCAGACTATGGTTGGAACACCATATTATTTATCACCAGAAATCGTTGAAAATCGT
CCTTATAATTTTAAAAGCGATGTTTGGGCTTTAGGGGTTTTAGTTTATGAAATCGCATGC
TTGAAACCTCCTTTTGATGCTTCTTCTTTACATTCTCTTGCTTTGAAAATTGTTAGAGGA
CAGTTCCAGCCAATGCCAAAACAGTTTTCTCAGCCTTTGAGGAATTTGGTTAGTAAAATG
CTTAAAACTGACCCTGCTTTAAGACCGACTGTGCATGAGATACTTAAAGAACCGATTATA
AGAGATAGGATTAAGAATTTTCTTAGTAGTTCACAAAGAAATAACGAGTTTTCACATACA
ATTATGCATAATTTTAGAATTGTTGATGAGACTGAGAAAGCGAGGGAGGATTTGAGTATT
ATGTCGAATCCAGAGGAAGAAAAAAAACAGGAGGAGATTAAAAAAGAAATGCTTAAATCG
GTGAGACAGTTAAAGAATGAGTTTAAGAATATGAAAGATTTGGATAAAGAGGAACAGGAA
GAAAAAATTATGTTGTGTGAGATGAATGAGATTGTTTTGTCTTGTGAAGATGATGTAACA
GAAGTATCTGTTCACAATAGTATTGTCGAAGTGCCTCCAGACCGTGATGACGAGATTGAC
GACAGCCACGAAAACGACATTTCTAGTAACCCCGAAGGAAAAATCAAACTTATGAAAGAA
TACTTGACCAAAATCCTAGGGAAAAAAAAACTCTCTGAAGCGAAAAAAATTATCAACGCC
CTTGTGCCAACAGAAGACGATTTAGATTTTGACATGCTATCTCCACATCTAGAGCATATC
CTCGACCAAAACCAACAAGGTGAATACGTGCCAATAATATACAGTCTTATCGAATTAGAA
CGTAGTATTTCTTAA