Identifiers and Description

Gene Model Identifier

SteCoe_16093

Standard Name

None

Aliases

None

Description

Pro_isomerase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007575501.8521167695179754e-45cyclophilin-RNA interacting pr
otein
WormBaseWBGene000008902.7487850079102147e-43
Oxytricha TrifallaxContig12239.0.g701.8048513878454153e-35Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16093(Protein)
MAVLLQTSLGDIVIDLYTSHCPNTCKNFLKLCKVKHYNNALFYAVEKDYLVQIANMQDDI
SIFGKLQGEKFRYIEDEFNPQIRHNRIGIVSMSNRGPDMNASNFFITLSALGEDYDLKHT
AFGIVQEGLNILKNINKSICDDSERPLRDIRIKHAYVLDDPFEDPEGLVEPESPLLITES
DYLLDDENIDESKNEIEIHESIKEHEGKARTVILEMLGDLPDADINPPDNAAFVCKLNSV
TTDQDLYLLFSRFGPIKSCQVIRDYKTGNSLQYGFIEFENTRNCEEAILRMDGVLIDRRR
IKVDFSQSVAKIWRKYRRGKKNSEKEPGIKIKDTLHVAKFKEDRHKMVFEPSEKIRKRSR
SR


>SteCoe_16093(CDS)
ATGGCAGTACTCTTACAAACTTCTTTAGGTGATATTGTGATAGATTTATATACAAGCCAT
TGCCCAAATACCTGCAAAAATTTCTTAAAGCTCTGCAAAGTAAAACACTATAACAACGCT
CTATTCTATGCTGTAGAAAAAGATTATCTAGTTCAAATTGCAAACATGCAAGACGATATC
TCGATATTTGGTAAACTCCAAGGTGAGAAATTTCGATACATTGAAGATGAATTTAACCCA
CAAATACGTCATAATCGTATAGGAATTGTGTCAATGTCCAATCGCGGTCCAGACATGAAT
GCCTCAAATTTCTTTATAACACTATCCGCATTAGGTGAAGATTATGATCTTAAACACACA
GCTTTCGGCATAGTCCAAGAAGGGTTAAATATTCTGAAAAACATTAACAAGTCTATATGT
GATGATTCAGAAAGACCACTTCGAGATATTAGAATAAAACATGCTTATGTATTAGATGAT
CCATTTGAAGACCCTGAAGGACTAGTTGAGCCTGAGTCTCCTTTGCTTATAACAGAAAGT
GATTATCTACTTGATGATGAGAATATTGATGAGAGTAAAAATGAGATAGAAATACATGAG
AGTATTAAAGAACATGAAGGTAAAGCTCGAACTGTAATACTAGAAATGCTTGGTGACCTA
CCTGATGCTGATATTAACCCACCTGATAATGCAGCTTTTGTGTGTAAATTGAATTCTGTG
ACTACTGATCAAGACCTTTACTTGCTATTTTCACGTTTTGGGCCTATAAAATCGTGTCAA
GTTATTAGAGATTACAAGACAGGGAACAGTTTGCAGTATGGGTTTATAGAATTCGAAAAC
ACAAGGAACTGTGAAGAAGCAATTTTAAGAATGGATGGAGTTCTTATAGATCGAAGGAGA
ATTAAAGTTGACTTTTCTCAATCAGTTGCAAAAATATGGAGGAAATATCGCAGAGGAAAA
AAAAATAGTGAAAAAGAACCTGGAATAAAAATCAAAGACACTCTGCATGTAGCAAAATTC
AAAGAAGATAGGCATAAAATGGTGTTTGAACCAAGTGAGAAAATAAGAAAGAGGTCGAGA
TCGAGATAG