Identifiers and Description

Gene Model Identifier

SteCoe_1619

Standard Name

None

Aliases

None

Description

Chitin_synth_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYNL192W9.854154686111257e-34Chitin synthase I; requires ac
tivation from zymogenic form i
n order to catalyze the transf
er of N-acetylglucosamine (Glc
NAc) to chitin; required for r
epairing the chitin septum dur
ing cytokinesis; transcription
activated by mating factor
Tetrahymena ThermophilaTTHERM_001349101.0806392777072785e-30Chitin synthase family protein
Oxytricha TrifallaxContig19394.0.g622.1705220113036395e-29Chitin synthase

WormBaseWBGene000004970.000000005602796437537268

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1619(Protein)
MEDLNYKCVILNQTFFREFIPGKEKPVEGIKIAKGLVDRNGDDIQFYNGLSNDDLRNRHK
FLVVVTMYNEPYNLLKMTLDAIEKNYCNKLENEMAVIVIADGIRPFVKSIETDEIEKKYS
KYFNLKDIYRELNISDEPNRHDINKLLDYEIEYGYEFETQNTSENNENIRNNIESVKKKA
EFAHVFYPREISGKMPVYFCVKQQNKRKLNSHLWYFGGFCKALNPEYCMLIDAGTVPEEN
SLFYLYKAMRNNPKVAGVCGEIIPKNDKDSIFDVLCYAQKVEYKFSHILDKALESTFGFI
TVLPGAFSGYRLETLGINDPDGPLWGDYFLSLKKPWSMDCYHANIYLAEDRVLCLALVSY
KDYVLKYVSKSKATTDPPQDFASLLTQRRRWINGSWFALLNSMRHWNRIWKSEHHCCRKA
VFTFQLFYYVINALYSFIMVGGFYLALSICLRMQLTSTVTPGQRSGVGDMIITFYLLLLI
LTIILSLGSNSKDIETTLKFVSSVFSIYMLVFIIFVVYLFFKNLNATAIWVPVSLTISGF
VLILLLNNTIWEVSLGCLQFILATPTYLNIFTIYAICNIHDCTWGNRPGDLTQDERDKMD
DFEKFRMVWVLLWALCNGYFSYFLDAADASKNSYSLYIYIVGLCGLSALYIRFIGGIIYV
FSEACSNCRSKEKNQDEDSNLV


>SteCoe_1619(CDS)
ATGGAAGACTTAAATTACAAATGTGTTATCCTCAACCAAACCTTTTTTAGAGAATTCATT
CCTGGAAAAGAAAAACCAGTTGAGGGTATTAAAATTGCTAAAGGCCTTGTAGATCGAAAT
GGAGATGATATACAATTTTACAATGGACTAAGTAATGATGATCTTAGAAATCGTCACAAA
TTCCTTGTTGTTGTGACTATGTACAATGAGCCTTATAATCTCTTAAAAATGACTCTTGAC
GCAATAGAAAAAAATTATTGCAACAAACTTGAAAACGAAATGGCAGTTATAGTGATTGCT
GATGGAATAAGACCATTTGTGAAATCGATTGAAACTGATGAAATAGAAAAAAAATATTCT
AAGTATTTTAATCTAAAAGATATCTACAGAGAACTTAATATCTCCGATGAACCAAATAGA
CATGACATAAATAAACTTTTAGACTATGAAATAGAATACGGTTATGAATTTGAAACCCAA
AACACAAGTGAAAACAATGAAAATATTCGAAACAATATAGAATCAGTCAAAAAAAAAGCT
GAATTCGCACATGTATTCTACCCAAGAGAAATTTCTGGAAAAATGCCTGTGTATTTTTGT
GTTAAGCAACAAAATAAAAGAAAGCTAAACAGCCATTTGTGGTATTTCGGGGGTTTTTGT
AAAGCTTTAAATCCAGAATACTGTATGCTTATAGATGCAGGAACTGTACCTGAAGAAAAT
TCTTTATTTTACCTTTATAAAGCTATGCGCAATAATCCTAAAGTAGCTGGAGTTTGTGGA
GAAATTATACCAAAAAATGATAAAGACTCAATTTTTGATGTATTATGCTATGCTCAAAAA
GTTGAATATAAGTTTTCACATATATTAGATAAAGCTCTTGAAAGTACTTTTGGGTTTATT
ACTGTTTTACCTGGAGCTTTTAGTGGATACAGGCTTGAAACTTTAGGAATTAATGATCCA
GATGGTCCATTATGGGGCGACTACTTTTTGTCTTTGAAAAAACCATGGTCAATGGATTGC
TATCATGCTAATATATATCTAGCTGAAGATAGAGTACTTTGTTTAGCTTTGGTAAGCTAC
AAGGATTATGTACTCAAGTATGTTAGTAAATCTAAAGCTACTACTGATCCTCCTCAAGAT
TTTGCAAGTCTTTTAACACAGCGGCGACGTTGGATAAATGGATCTTGGTTTGCTTTGTTG
AATTCTATGCGTCATTGGAATCGTATATGGAAATCAGAACATCATTGTTGTAGAAAAGCC
GTTTTTACATTTCAATTATTTTATTATGTAATCAACGCTCTTTATTCTTTTATTATGGTT
GGGGGGTTTTATTTGGCATTGTCGATATGTTTAAGAATGCAACTCACATCAACAGTTACC
CCAGGCCAGAGAAGTGGAGTTGGGGATATGATCATAACATTTTATTTACTTTTACTTATT
CTTACAATTATCCTCAGTTTGGGAAGCAATAGCAAAGATATAGAAACAACCTTAAAGTTT
GTTAGTTCAGTCTTTTCAATTTACATGCTTGTCTTTATAATATTTGTTGTTTATCTGTTT
TTTAAAAACCTAAATGCAACTGCAATATGGGTGCCTGTGAGTTTAACAATATCTGGGTTT
GTTTTAATCCTTTTATTGAATAATACAATTTGGGAAGTTTCTCTAGGCTGTTTACAGTTT
ATATTAGCAACACCAACTTATTTGAACATATTTACTATTTATGCAATCTGTAATATCCAT
GACTGCACATGGGGGAACCGTCCAGGTGATTTGACACAAGACGAACGTGATAAAATGGAT
GATTTCGAGAAATTCCGTATGGTTTGGGTTTTACTTTGGGCCTTATGCAATGGGTATTTT
TCATATTTTCTCGATGCAGCTGATGCTAGCAAGAATTCATATAGTTTATACATCTATATT
GTAGGTTTATGTGGGCTTTCAGCATTATATATCCGTTTTATTGGTGGAATTATTTATGTT
TTTAGTGAAGCGTGTTCAAATTGTAGGTCCAAAGAAAAAAATCAAGATGAAGATAGTAAT
CTAGTTTAA