Identifiers and Description

Gene Model Identifier

SteCoe_16339

Standard Name

None

Aliases

None

Description

CSN8_PSD8_EIF3K domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006491101.5628821893349888e-1826S proteasome non-ATPase regu
latory subunit Nin1/mts3 famil
y protein
Oxytricha TrifallaxContig2043.0.g700.00000000000003442477108469977SAC3/GANP/Nin1/mts3/eIF-3 p25
family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16339(Protein)
MSLQALKQGTSTLELNLSISSPPDLLNAVNSLWQVAIQVPSMPPSAVKNESELKGIRDFF
EAALKCYIKCADFTGIEQCFEILTNLYQDYSEILKDSEDQWKIWGLYLTYLLSYNKIEEF
HSELESVPWNLYTDNKYIQFAVTLEQFFMEGNYQEVLSAKNHSPSSEFDFFINRISDTIR
FEIASSFEKAYEKLSVEGACQLLKLNDYSELAAFLQAYAERSGKDIWRIENNELLIKSNE
KKTHEIPKWQLINQALNYAIELERIV


>SteCoe_16339(CDS)
ATGTCGCTTCAAGCTTTGAAACAAGGGACTTCAACTTTAGAATTGAATCTCAGCATTTCA
AGTCCTCCCGACCTTTTAAACGCTGTAAATTCTTTATGGCAAGTCGCTATACAAGTACCT
TCAATGCCCCCGTCTGCTGTGAAAAATGAGTCTGAGCTTAAAGGAATTAGAGACTTTTTT
GAAGCAGCTTTGAAATGTTATATCAAATGTGCAGATTTCACTGGGATTGAACAATGCTTT
GAAATACTCACTAATTTATATCAAGATTATAGCGAGATTCTTAAGGATAGTGAAGATCAA
TGGAAAATCTGGGGCCTTTATTTGACTTACCTACTTTCTTATAATAAGATAGAAGAATTT
CACTCTGAGCTTGAGTCTGTGCCTTGGAATTTGTATACAGATAACAAATATATACAGTTC
GCTGTGACGCTTGAGCAGTTTTTCATGGAGGGAAATTACCAAGAGGTCCTTTCAGCGAAA
AACCACTCCCCATCAAGTGAATTCGACTTTTTTATCAACAGAATTTCTGACACAATCCGC
TTTGAAATCGCTTCGAGCTTCGAAAAAGCTTATGAAAAACTCTCAGTCGAAGGTGCCTGC
CAGCTTCTTAAACTAAACGACTATTCAGAACTTGCAGCTTTTCTTCAAGCCTACGCTGAA
CGATCAGGAAAAGATATTTGGAGGATAGAAAACAATGAGCTTCTTATCAAAAGCAATGAA
AAAAAAACTCATGAAATTCCCAAATGGCAACTCATCAATCAAGCTTTAAACTACGCAATA
GAACTAGAAAGAATAGTTTAA