Identifiers and Description

Gene Model Identifier

SteCoe_16384

Standard Name

None

Aliases

None

Description

RRM_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000110436.305116760146989e-16
Tetrahymena ThermophilaTTHERM_006574600.000000000000001713908431542013RNA recognition motif-containi
ng protein
Saccharomyces CerevisiaeYPL043W0.000000000000004658886145103398Nucleolar protein; essential f
or processing and maturation o
f 27S pre-rRNA and large ribos
omal subunit biogenesis; const
ituent of 66S pre-ribosomal pa
rticles; contains four RNA rec
ognition motifs (RRMs)
Oxytricha TrifallaxContig14672.0.g470.000000000000012664165549094176RNA recognition motif. (a.k.a.
RRM, RBD, or RNP domain)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16384(Protein)
MKKLGKHGGRLIIRNLPFSIEENFLRKTLEKIGTLKEFHVPLDLDKKRNKGFAFVEYEKK
NLSEKAIKALNGMKIQKREISVDYALSKDKYLTTKKSEEMAKDFKHQDNDEDMEIVDEAK
EDDEQEEVEEEDNEEIKKKELKFEDGTTLFIMNLNYETGEDDLFEFFKDFGKIKYVKVCV
NKETGESRGSGFVCFKKAEDADKVVKIADEQGVELQERSLKIMKAVSKETAVNLKSAKPP
KNDGRNLYLSKLSLIQVGSEMFKTLTPKEIEMRTSAAKKMIEKLQNPNIFVSPTRLLFKN
ISKVISDDDLKILVKKILFDSNPELQSQKLFKQVKILKEPEKLDKKGNPMSKGIAFIEFK
KHEYALLAQEKCNNDSKYFGQKHRPIVEFALEDHRILRIRKLKLKRQKQAQEKMNDGKSS
KKKLGRGKRQRLKRQKAVENKESL


>SteCoe_16384(CDS)
ATGAAAAAGCTGGGAAAACATGGAGGTAGGCTTATTATAAGAAACCTTCCTTTTTCCATA
GAAGAAAATTTTTTGAGGAAAACCCTTGAAAAAATAGGGACCCTTAAAGAATTTCACGTT
CCTTTAGACCTGGATAAAAAAAGGAATAAAGGATTTGCTTTTGTTGAGTATGAGAAAAAG
AACTTGTCAGAAAAAGCAATCAAGGCTCTGAATGGAATGAAGATCCAGAAACGAGAAATT
TCAGTTGACTATGCTTTAAGTAAAGACAAGTACTTGACAACAAAGAAAAGTGAAGAGATG
GCTAAAGATTTCAAACATCAGGATAATGATGAGGATATGGAAATTGTGGATGAAGCGAAA
GAAGATGATGAACAAGAAGAGGTTGAAGAAGAAGATAATGAGGAAATTAAGAAAAAAGAA
TTGAAGTTTGAGGATGGAACAACTTTGTTTATTATGAATTTGAACTATGAAACAGGGGAA
GATGATCTTTTTGAGTTTTTTAAAGATTTCGGCAAGATAAAATATGTGAAAGTTTGTGTG
AATAAAGAGACTGGAGAATCTCGTGGAAGTGGATTTGTTTGTTTTAAAAAAGCTGAAGAT
GCTGATAAAGTTGTTAAGATTGCTGATGAGCAGGGTGTTGAACTACAGGAAAGGAGTTTG
AAAATTATGAAAGCGGTGAGTAAAGAAACTGCAGTAAATCTAAAAAGTGCAAAACCCCCT
AAGAATGATGGTAGAAATTTGTATTTGAGTAAGTTAAGTTTGATTCAAGTTGGAAGTGAA
ATGTTTAAAACCTTAACACCAAAGGAAATCGAAATGCGTACATCAGCAGCCAAAAAAATG
ATCGAAAAGCTCCAAAACCCTAACATATTCGTATCTCCAACCCGTCTTCTATTCAAAAAC
ATCTCAAAAGTTATATCCGACGACGACCTAAAAATCCTAGTAAAAAAAATCTTATTTGAC
TCAAACCCAGAGCTTCAATCCCAAAAGTTATTCAAACAAGTGAAAATCCTTAAAGAACCA
GAAAAACTAGACAAAAAAGGAAATCCTATGTCAAAAGGCATAGCATTTATAGAGTTTAAA
AAACATGAATACGCTTTATTAGCCCAAGAAAAATGTAATAATGACTCAAAATACTTTGGG
CAAAAACACAGACCTATAGTAGAATTTGCTTTAGAAGACCATAGAATCCTTCGTATACGT
AAACTTAAGCTTAAAAGGCAAAAACAAGCTCAAGAAAAAATGAACGACGGGAAAAGTTCT
AAGAAAAAACTTGGACGAGGGAAACGACAAAGGCTTAAAAGACAAAAAGCTGTAGAAAAC
AAAGAAAGTTTATAG