Identifiers and Description

Gene Model Identifier

SteCoe_16437

Standard Name

None

Aliases

None

Description

Catalase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig8519.0.g170Catalase

WormBaseWBGene000008310
Saccharomyces CerevisiaeYDR256C9.710436457780846e-67Catalase A; breaks down hydrog
en peroxide in the peroxisomal
matrix formed by acyl-CoA oxi
dase (Pox1p) during fatty acid
beta-oxidation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16437(Protein)
MADRSRPLTTSWGKPVDNNQNSLTAGPRGPILMQDVHLIDKLASFDRERIPERVVHAKGA
GAHGYFEVTHDVTKYCKAKFLEKVGKRTPVFTRVSTVGGERGSADTERDPRGFAVKFYTE
EGNWDFVGNNTPIFFIRDPLKFADFIHTQKRDPKTNLKCANMFWDFLSLTPESTHQITYM
FGNRGTPDGFRRMNGYGSHTYKWVNAKEEDFFVKFHFKTDAGVKNLKGPEAAKLAGEDPD
YATRDLFHHINNGNAATWTFCVQIMTPEQAEKYKFDIFDVTKVWPHSDFPLIPVGKMVLN
RNPSNYFAEVEQSAFCPAVMVPGIEPSYDKMLQARLFSYTDTHRHRLGGNFTKIPINCPY
MARVAHHQRDGYMVTDGNNGGEPNYEPNSVEGTPKEVPSARQKPVPVSGLIARHPYTHPN
CNFEQPGVLFRKVMDDENKSDIVGNLVRHMKNITRKGIAERQVQHFYKSDPEYGTRVAQG
LGLPVHAAKL


>SteCoe_16437(CDS)
ATGGCTGACAGAAGTCGTCCACTTACAACCAGCTGGGGTAAACCAGTAGATAACAATCAA
AACTCACTGACTGCTGGACCTCGTGGGCCTATCTTAATGCAAGATGTGCACCTAATAGAC
AAGCTGGCGAGTTTTGATCGTGAAAGAATCCCAGAACGTGTTGTTCACGCCAAAGGTGCA
GGGGCACACGGATATTTCGAGGTAACTCATGACGTCACCAAATACTGCAAAGCTAAATTT
TTAGAAAAAGTAGGAAAAAGAACTCCAGTTTTCACAAGAGTCTCTACAGTAGGTGGAGAA
CGTGGATCAGCTGATACTGAAAGAGACCCAAGAGGTTTTGCAGTTAAATTCTATACTGAA
GAAGGTAATTGGGACTTTGTCGGCAACAACACTCCCATCTTTTTCATTAGAGACCCATTG
AAATTTGCTGATTTCATTCACACCCAAAAACGTGATCCTAAGACTAATTTGAAATGCGCA
AATATGTTCTGGGATTTCTTAAGCCTTACCCCTGAATCAACTCATCAGATTACTTATATG
TTTGGAAATAGAGGAACTCCTGATGGTTTTAGAAGAATGAATGGTTATGGGTCTCATACT
TATAAATGGGTTAATGCTAAAGAAGAAGACTTTTTTGTCAAATTCCATTTTAAGACTGAT
GCTGGAGTGAAAAATCTTAAAGGACCAGAAGCGGCTAAACTTGCTGGTGAAGACCCTGAT
TATGCTACAAGGGATTTGTTCCATCATATTAATAATGGAAATGCAGCTACTTGGACTTTT
TGTGTTCAGATCATGACCCCAGAACAAGCTGAAAAGTATAAGTTTGATATATTTGATGTT
ACTAAGGTATGGCCTCATAGTGACTTCCCACTTATCCCTGTAGGTAAAATGGTTTTGAAT
AGAAACCCTAGCAACTATTTTGCTGAAGTTGAACAGTCTGCTTTCTGCCCTGCAGTGATG
GTACCTGGTATTGAACCTTCTTATGATAAAATGCTTCAAGCTAGATTGTTTTCTTATACT
GATACCCATAGACATAGACTTGGAGGTAACTTTACTAAAATCCCAATTAACTGTCCTTAT
ATGGCAAGAGTAGCTCATCATCAAAGAGATGGATACATGGTTACTGATGGAAACAATGGA
GGCGAACCTAACTATGAACCTAATTCAGTTGAAGGAACTCCTAAAGAAGTCCCATCTGCA
AGACAAAAACCTGTACCTGTCAGTGGTTTGATTGCTAGACACCCATACACTCATCCAAAT
TGCAATTTTGAACAACCAGGTGTATTGTTTAGAAAAGTTATGGATGATGAAAACAAGAGT
GATATTGTTGGCAACCTTGTTAGACATATGAAGAATATCACTAGAAAAGGGATTGCTGAA
AGACAAGTCCAACACTTTTATAAGAGTGATCCAGAGTATGGCACTCGTGTAGCCCAGGGT
CTTGGTCTCCCAGTACACGCAGCTAAACTTTAG