Identifiers and Description

Gene Model Identifier

SteCoe_16450

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000955301.4788975056432133e-74DEAD/DEAH box helicase family
protein. Sequence similarity t
o a protein kinase family uniq
ue to Tetrahymena thermophila
(Eisen et al., 2006)."
Oxytricha TrifallaxContig22569.0.g632.970445045520691e-73DEAD/DEAH box helicase

WormBaseWBGene000120594.408531331463226e-71
Saccharomyces CerevisiaeYHR065C1.0648786602415064e-63Protein involved in rRNA proce
ssing; required for maturation
of the 35S primary transcript
of pre-rRNA and for cleavage
leading to mature 18S rRNA; ho
mologous to eIF-4a, which is a
DEAD box RNA-dependent ATPase
with helicase activity

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16450(Protein)
MSEIESSLPIYEENTSNLSFKDLGVCSELCVACEKLGFIKPTSIQCESIPYGLNKKDLIA
LAVTGSGKTAAFVIPILQHLLETPTSLYALIMTPTRELAIQISEQCEALGAFIGLKTAVL
VGGLDLMQQAIALSKKPHIVIGTPGRVADHLQNTKGFNLNSICFLVLDEADKLLNMDFGK
EIDLIVSACPQERTTFLFSATMTNKVQKLQRACLKKDAVKVQVSTKYQTVDSLIQEFLFI
PSAHKDTYLYSILQLFMGNLVIIFTETSANASKLTLLLNKLGMKAVALFGKLSQDKRIES
LNKFKGKGRNILVATEVASRGLDIPSVDIVINYDVPVQSKNYIHRVGRTARAGKSGRAIT
LVTQYDVVLFQRVESLLGKKLESFPIDKEKVMLEHEKVLETLRNVNKEIKDQDRDSDEER
LDDEGNIVTTKKRPKSKGHKGTKKRFKK


>SteCoe_16450(CDS)
ATGTCAGAAATCGAATCCTCACTGCCAATATACGAAGAAAACACCTCAAATCTTTCATTT
AAAGACCTTGGGGTCTGTTCAGAATTATGTGTGGCTTGTGAGAAGTTAGGTTTCATAAAA
CCGACAAGTATTCAATGTGAGTCTATCCCTTATGGTTTAAACAAAAAAGATCTTATCGCT
TTAGCCGTAACAGGTTCAGGTAAAACCGCAGCATTTGTAATTCCAATTCTCCAACATTTA
TTAGAAACCCCAACAAGTTTATATGCTCTTATAATGACCCCAACAAGAGAATTAGCTATA
CAAATAAGCGAGCAATGCGAAGCTTTAGGAGCATTTATTGGTTTAAAAACAGCAGTTTTA
GTTGGTGGCTTAGATTTAATGCAACAAGCTATAGCACTTAGTAAAAAACCTCATATTGTC
ATTGGTACACCAGGAAGAGTTGCAGACCATCTTCAAAACACAAAAGGATTCAATTTAAAC
TCAATATGCTTTTTAGTCTTAGATGAAGCTGATAAACTGTTAAACATGGATTTTGGTAAG
GAAATTGATTTGATTGTTTCAGCATGTCCTCAAGAAAGAACCACTTTTTTGTTTTCAGCC
ACCATGACTAATAAAGTTCAAAAACTTCAGAGGGCTTGTCTTAAAAAAGATGCTGTTAAA
GTACAGGTCTCGACGAAATATCAAACTGTTGACTCGCTTATACAAGAGTTTCTTTTTATC
CCTTCAGCTCATAAAGATACTTATTTGTATTCGATTTTACAGCTTTTCATGGGCAATTTG
GTTATTATTTTTACAGAAACCTCAGCAAATGCATCAAAACTAACTCTTTTACTTAATAAA
CTCGGTATGAAAGCTGTAGCATTGTTTGGAAAGCTAAGCCAGGACAAAAGGATAGAAAGT
TTGAACAAATTTAAAGGCAAAGGGAGAAATATTCTTGTTGCAACTGAAGTGGCAAGTAGA
GGTTTAGATATTCCATCAGTTGATATAGTCATTAATTATGATGTTCCAGTACAAAGCAAA
AATTATATTCATAGAGTTGGGCGTACAGCTCGTGCTGGTAAATCAGGAAGGGCAATAACC
CTAGTAACCCAATATGATGTCGTGCTTTTCCAAAGAGTCGAATCCTTATTAGGTAAAAAA
CTTGAATCTTTCCCAATCGACAAAGAAAAAGTTATGCTTGAGCATGAAAAAGTTCTTGAA
ACTCTTAGAAATGTAAACAAAGAAATTAAAGATCAAGATCGAGATAGCGATGAAGAAAGA
TTAGATGATGAAGGGAATATCGTGACTACAAAAAAAAGACCAAAATCTAAAGGACACAAA
GGGACAAAGAAGAGATTTAAGAAATAA