Identifiers and Description

Gene Model Identifier

SteCoe_16720

Standard Name

None

Aliases

None

Description

AAA_11 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12772.0.g458.628801156620959e-60AAA domain

Tetrahymena ThermophilaTTHERM_003399402.572209372642415e-56hypothetical protein
Saccharomyces CerevisiaeYKL017C1.2160992992528256e-37Hexameric DNA polymerase alpha
-associated DNA helicase A; in
volved in lagging strand DNA s
ynthesis; contains single-stra
nded DNA stimulated ATPase and
dATPase activities; replicati
on protein A stimulates helica
se and ATPase activities
WormBaseWBGene000149653.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16720(Protein)
MDLISKTLELLQLEHGAEIEESLNNRSNCSIRELEKQGLCVTKLMICGCKTGLFGRVLVK
LKKEFADLPQHKMSPGDIVGIFQEDIKNPEVNGTVYKVTQNTITVACEGMIEMQGKVSVV
ILANEATYKRQREIMEKLRNLNVNHPSYCLAEILLGSSQAKFTXKLRNLNVNHPSYGLAE
ILLGSSQAKFTMVEYPLDFSNSNLNSVQKHAVQFTLNQCVNFGIIHGPPGTGKTTTVVEL
ILQAVKRGIQVLVTAPSNIAVDNLVEKLAGKARIVRVGHPARMLPTITQYSFDNLLKKTD
AYQITQDIRKELNSLSKYSRQEARILRKELKSRDGKAAEEVLENSQVVLSTCISSGTKFM
VEYAAKIKGFGLVVIDEAAQALECACWVPVLLGKKVVLAGDHKQLPPTIMSEQAAREGLQ
VSMMERLCDLYPNSAVLLEIQYRMNELIMNWSNKEFYFGRLIAHDSVKNRVFDDFPYPLV
LVDTSGGGVYDAGEISKFNSGEAEIVGKFCQELFDYGIKDVAVITPYNAQVELIRGIVPK
AEVSSVDGFQGREKDAVVISMVRSNSNQDVGFLQDFRRLNVAITRAKMLVCLIMDCDTVG
SKKSPPFLQHLCEYFSTNAHCLNFHEYYTGGISYQSKELVQKQAKDQERKQKTKEKEKEK
PKNQNQIEQNLPKNQSKIIKDVYKETLEKIEILKKSDEESFKTEKLNAKDRHSIHEFCQK
HNLYHKTLGSGKDKRMLISKIFPKPGQKETVFIQPTNNSEDDKEEEEEEEEKKIQGPFIA
TKITQKKEKIIEEYDEDKFLEAAMAQANKCMKEGCKSIIGVLKTVCKYCHGGFCIAHGLA
EAHGCGNRAHEISLKEHRMPTKPSEARVNALKETMHQKIQSMNNRKPKDKKKKKK


>SteCoe_16720(CDS)
ATGGACTTAATATCGAAGACTTTAGAATTGTTGCAATTAGAACATGGTGCGGAGATAGAA
GAAAGTTTGAATAATAGGTCAAATTGTAGTATAAGAGAACTTGAAAAACAAGGACTTTGT
GTTACAAAATTGATGATTTGTGGATGTAAGACTGGACTTTTTGGTAGGGTTTTGGTTAAG
TTGAAGAAAGAATTTGCTGATTTACCTCAGCATAAGATGTCGCCTGGGGATATTGTTGGG
ATTTTTCAAGAGGATATTAAAAATCCTGAGGTTAATGGCACGGTTTATAAGGTTACACAG
AATACGATTACTGTTGCTTGTGAAGGTATGATTGAGATGCAAGGTAAGGTTTCTGTGGTA
ATATTAGCTAATGAAGCTACGTATAAGAGACAAAGAGAGATTATGGAGAAACTTAGAAAC
TTAAATGTTAACCACCCAAGCTATTGTTTGGCAGAGATATTATTAGGATCATCACAAGCA
AAGTTTACAANAAAACTTAGAAACTTAAATGTTAATCACCCAAGCTATGGTTTGGCAGAG
ATATTATTAGGATCGTCACAAGCAAAGTTTACAATGGTTGAGTATCCTCTTGATTTCTCC
AACTCAAACCTAAACTCTGTACAAAAACATGCAGTCCAATTCACCCTTAACCAATGTGTG
AATTTTGGTATTATCCATGGACCACCTGGTACTGGGAAAACAACAACTGTAGTCGAACTT
ATCTTACAAGCAGTAAAACGTGGAATTCAAGTTCTAGTTACAGCTCCATCAAATATAGCC
GTCGATAATTTAGTAGAAAAATTAGCTGGTAAAGCTCGTATAGTACGTGTTGGACACCCA
GCAAGAATGCTTCCAACCATAACCCAATATTCTTTTGATAACCTTTTAAAGAAAACCGAT
GCTTATCAAATAACTCAAGATATTCGAAAAGAACTTAATTCCTTATCAAAATATTCACGT
CAAGAAGCTCGTATTTTAAGAAAAGAACTCAAAAGCCGTGATGGTAAAGCTGCAGAAGAA
GTTTTAGAAAACAGTCAGGTTGTTCTTTCTACATGTATAAGTTCAGGGACTAAATTTATG
GTTGAATATGCAGCAAAAATTAAAGGATTTGGTTTGGTTGTTATAGATGAAGCTGCTCAA
GCTCTTGAATGTGCTTGTTGGGTCCCTGTTTTATTAGGTAAAAAAGTTGTATTGGCTGGA
GACCATAAACAACTTCCTCCAACTATTATGTCAGAACAAGCAGCTAGAGAAGGGTTACAG
GTTAGTATGATGGAAAGATTATGTGATTTATACCCAAATAGTGCAGTTTTATTAGAAATA
CAGTATAGGATGAATGAACTTATTATGAATTGGTCAAATAAAGAGTTTTATTTTGGAAGG
CTTATTGCTCATGATAGTGTTAAAAATAGGGTTTTTGATGACTTTCCATATCCTTTGGTG
TTAGTGGATACTAGTGGTGGAGGAGTTTATGATGCTGGGGAGATTTCTAAGTTTAATAGT
GGGGAAGCGGAGATTGTTGGGAAGTTTTGTCAGGAGTTGTTTGATTATGGGATTAAAGAT
GTTGCTGTGATTACTCCTTATAATGCACAAGTTGAATTGATTAGAGGTATTGTCCCTAAA
GCTGAAGTATCATCTGTTGATGGGTTTCAAGGTAGAGAAAAAGATGCTGTGGTTATTAGC
ATGGTACGTTCGAATTCCAACCAAGATGTCGGGTTCCTGCAAGACTTCCGAAGACTAAAT
GTGGCAATAACCCGAGCTAAAATGCTTGTTTGCCTTATAATGGACTGCGACACAGTAGGT
TCCAAAAAATCTCCACCTTTCCTCCAACACCTTTGTGAATATTTTTCCACAAATGCCCAT
TGCCTAAATTTCCATGAATATTATACTGGAGGCATAAGTTATCAAAGTAAAGAACTTGTT
CAAAAACAAGCTAAAGACCAAGAACGTAAACAAAAAACAAAAGAAAAAGAAAAAGAAAAA
CCTAAAAATCAAAACCAGATAGAACAAAACCTACCTAAAAATCAATCAAAAATCATAAAA
GATGTATACAAAGAAACTTTAGAAAAAATCGAAATACTAAAAAAATCAGATGAAGAGTCA
TTTAAAACTGAAAAACTTAATGCTAAAGATCGTCATTCAATACATGAATTCTGCCAAAAA
CACAATTTATATCACAAAACCTTAGGAAGTGGTAAAGATAAACGTATGCTTATATCGAAA
ATTTTTCCAAAACCAGGGCAAAAAGAAACAGTTTTCATACAGCCGACGAATAATTCAGAA
GATGATAAAGAAGAGGAAGAAGAAGAAGAAGAAAAAAAGATTCAAGGTCCTTTTATAGCA
ACAAAAATTACTCAGAAGAAAGAAAAAATAATCGAAGAATATGATGAAGATAAGTTTTTA
GAAGCAGCTATGGCCCAAGCTAATAAATGTATGAAAGAAGGATGTAAAAGTATTATCGGG
GTATTAAAAACTGTATGCAAATATTGTCATGGAGGATTTTGTATAGCTCATGGGCTTGCT
GAAGCACATGGATGTGGTAATAGAGCCCATGAGATATCTTTAAAAGAACATAGAATGCCT
ACTAAGCCCTCAGAAGCTAGAGTTAATGCATTAAAAGAAACTATGCATCAGAAAATACAA
AGTATGAACAATAGAAAACCAAAAGACAAAAAGAAAAAGAAAAAGTAA