Identifiers and Description

Gene Model Identifier

SteCoe_16767

Standard Name

None

Aliases

None

Description

His_Phos_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_011935501.5628821893349888e-18Lysosomal acid phosphatase
Oxytricha TrifallaxContig15876.0.g996.305116760146989e-16Histidine phosphatase superfam
ily (branch 2)

WormBaseWBGene000151610.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16767(Protein)
MLAFLLCLYTTHAALLSVIETCRHGARAPIDFYQWDQGYWNEGMGELTQEGMRQQFLNGA
EFRSRYVNSTSNIPGTYNASQLYVRSTDVNRTIMSAESQMMGLFPTGPNIASNMQYKAVP
PFGSINFNTTIQGLGLEALPNAYQPVPIHVVAAPYDNMLYGYSSTSCPRMAEISSQVQNS
ADYQFRVQNYTAYLGKQLYEIFNTPVSYEYAGWYGDVLICDSFHGYSWPEGITEEMFQQM
IGIMNYSNSYFYQNGGAQLASSQFFSQIINTFTGVINGTSTLKWSLYSAHDTTLIGFLYA
MNQFSGNNPPFASTIVFELHSVLNNKYAVQIIFNDEVLVLDGCTEMCDFDTFVQLMNAWI
IPDVVAACQMTGEHDLRNLAYNPFMHGRS


>SteCoe_16767(CDS)
ATGCTTGCTTTCCTCTTGTGTTTATACACCACGCATGCTGCACTTCTAAGTGTCATTGAA
ACATGCAGACATGGGGCAAGAGCACCAATAGACTTTTACCAATGGGACCAAGGGTACTGG
AATGAAGGCATGGGAGAATTAACTCAAGAAGGTATGAGACAACAGTTTTTAAATGGAGCT
GAGTTTAGAAGTCGATATGTAAACTCAACTAGCAACATTCCTGGAACTTACAATGCTAGT
CAGCTTTATGTCAGAAGCACAGATGTCAACAGGACAATCATGTCAGCTGAAAGCCAAATG
ATGGGGCTTTTCCCTACAGGACCGAACATAGCTAGTAACATGCAGTACAAAGCAGTTCCT
CCATTTGGTTCTATAAACTTCAACACGACAATACAAGGACTTGGCCTTGAAGCGCTACCA
AATGCATATCAGCCAGTTCCAATTCATGTAGTTGCAGCTCCATATGATAACATGCTCTAT
GGCTACTCCTCAACTTCTTGTCCTAGAATGGCCGAAATATCATCACAAGTTCAAAACTCA
GCCGATTATCAATTCCGTGTGCAAAACTATACAGCTTATCTAGGCAAACAACTTTATGAA
ATTTTCAACACCCCTGTCAGCTATGAATATGCCGGCTGGTATGGAGATGTTTTAATATGT
GATAGTTTTCACGGGTATTCATGGCCTGAGGGTATTACTGAAGAAATGTTTCAGCAAATG
ATTGGAATTATGAACTATTCAAACTCTTACTTTTACCAAAATGGAGGTGCTCAATTAGCA
TCATCTCAGTTTTTTTCACAAATAATCAATACATTTACTGGGGTTATTAATGGAACATCT
ACTTTGAAATGGAGTTTATATTCAGCACATGATACAACTTTGATAGGGTTTTTGTATGCT
ATGAACCAATTTAGTGGAAACAATCCACCTTTTGCATCGACTATTGTATTTGAATTGCAT
AGTGTACTGAATAACAAATATGCTGTGCAGATTATATTTAATGATGAGGTTTTGGTGCTC
GATGGGTGTACTGAGATGTGTGATTTCGATACTTTTGTTCAGTTAATGAATGCTTGGATT
ATACCTGATGTTGTAGCAGCATGTCAGATGACAGGAGAGCATGATTTGAGGAATTTGGCA
TATAATCCTTTTATGCATGGACGTAGTTAA