Identifiers and Description

Gene Model Identifier

SteCoe_16829

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig2122.0.g980DEAD/DEAH box helicase

WormBaseWBGene000020830
Saccharomyces CerevisiaeYDR021W1.7785284761271306e-68Nucleolar protein required for
maturation of 18S rRNA; membe
r of the eIF4A subfamily of DE
AD-box ATP-dependent RNA helic
ases

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_16829(Protein)
MDDYNRWLMEQTEEFIIDSNWHEVTETFDDMNLKQPLLRGIYSYGFEKPSAIQQKGIKPI
ILGRDTIAQAQSGTGKTATFTVGMLELIDTSVIQCQALILAPTRELAQQIHRVVLQIGQY
SKINCHACIGGTVVREDIRILEKGVHAVVGTPGRVFDMISRNHLSTQHLKIFVLDEADEM
LSRGFKDQIQEIFRHLPGSIQCCLFSATMPPEILKLTNDFMRDPIRILVKKDELTLEGIA
QYYIPIEKEDWKFATLADLYENLDIAQAIIYANTRKKVETLSKQMIEKDFVVSFMHGEMD
QTQRELIMKEFRTGSTRVLITTDLLARGIDVQQVSLVINYDMPTNYENYLHRIGRSGRFG
RKGVAINFVTESDAQFLKDLEQHYNTSIEELPEDLSNLL


>SteCoe_16829(CDS)
ATGGATGATTATAATAGGTGGTTGATGGAGCAAACAGAAGAATTTATAATTGACTCGAAC
TGGCACGAAGTGACCGAAACGTTCGATGACATGAACTTGAAGCAGCCTCTTTTACGGGGG
ATCTACTCTTACGGGTTCGAAAAGCCATCAGCCATCCAACAGAAGGGTATTAAGCCAATA
ATCTTGGGTCGAGATACAATCGCCCAAGCCCAATCAGGAACAGGTAAAACAGCCACATTT
ACTGTAGGGATGCTTGAGCTTATAGACACTTCTGTAATTCAATGTCAAGCTTTAATCTTA
GCCCCAACTCGTGAACTGGCCCAACAAATCCACAGAGTTGTTCTTCAGATCGGCCAATAT
TCCAAAATAAACTGTCACGCTTGCATAGGTGGGACCGTTGTAAGAGAAGATATTAGAATA
CTTGAAAAGGGAGTCCACGCAGTTGTTGGAACACCAGGACGAGTATTTGATATGATCTCA
AGGAACCATTTGTCGACTCAGCATTTGAAGATTTTCGTATTAGACGAAGCTGATGAAATG
CTTTCTAGAGGGTTTAAAGACCAGATACAAGAAATATTTAGACATTTACCTGGAAGCATC
CAGTGCTGTTTGTTTTCAGCTACGATGCCACCTGAAATCCTAAAACTTACTAATGATTTT
ATGAGAGACCCGATTAGGATTCTTGTTAAAAAAGACGAGTTAACATTGGAAGGTATTGCC
CAGTATTATATTCCAATTGAAAAGGAAGATTGGAAATTCGCCACTTTAGCTGATTTGTAT
GAGAATTTGGATATTGCTCAGGCGATTATATATGCAAATACTAGGAAAAAGGTTGAAACT
CTTAGTAAACAGATGATAGAAAAGGATTTTGTTGTGTCGTTTATGCATGGAGAAATGGAT
CAGACACAAAGAGAATTGATTATGAAAGAGTTTAGGACTGGATCGACTAGAGTTTTAATT
ACTACTGATTTGCTGGCTAGAGGTATTGATGTACAGCAGGTCAGTTTGGTTATTAATTAT
GATATGCCAACCAATTATGAGAATTATTTGCATAGGATTGGACGTAGTGGGAGATTTGGC
AGAAAGGGGGTAGCTATAAACTTTGTCACAGAAAGCGATGCGCAGTTTTTGAAAGACCTG
GAACAGCATTATAATACAAGCATTGAGGAATTGCCTGAAGATCTTAGTAACTTACTTTAG