Identifiers and Description

Gene Model Identifier

SteCoe_17004

Standard Name

None

Aliases

None

Description

UFD1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig726.1.g1162.9374821117108028e-30Ubiquitin fusion degradation p
rotein UFD1

Tetrahymena ThermophilaTTHERM_003551301.185064864233981e-27ubiquitin fusion degradation U
FD1 family protein
WormBaseWBGene000067333.873997628687187e-21
Saccharomyces CerevisiaeYGR048W3.1391327920480296e-17Substrate-recruiting cofactor
of the Cdc48p-Npl4p-Ufd1p segr
egase; polyubiquitin binding p
rotein that assists in the dis
location of misfolded, ERAD su
bstrates that are subsequently
delivered to the proteasome f
or degradation; involved in re
gulated destruction of ER memb
rane proteins such as HMG-CoA
reductase (Hmg1/2p) and cytopl
asmic proteins (Fbp1p); involv
ed in mobilizing membrane boun
d transaction factors by regul
ated Ub/proteasome-dependent p
rocessing (RUP)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17004(Protein)
MDFFGLRPHHRHHQQGFIETYKAVPASFFGKEEVEKGNMIILPSSAARYILSQSSQNPML
FKITNQQLNISSNCGVLEFTAEEGYCLLPYWLMQHLGLSEGGDVLIESVTLPKGTFVKIQ
PHETAFIDLPNPKAVLENGLRNYLCLTKGDSIVIEFAKKRYGIDIIETRPANAIMTIQTD
LQVDFAPPKDYKEEPVLKKEPSITFGKEEQKTRSGNKTITGYTLEGKKVEFTSGNKDDEE
REYDPRQHRIPNGIKNAPVIVNPNYWDSMKGGRKLN


>SteCoe_17004(CDS)
ATGGATTTTTTTGGGCTTAGACCACATCATAGGCATCATCAGCAAGGGTTTATTGAGACA
TACAAAGCAGTGCCAGCTTCGTTTTTCGGCAAAGAAGAGGTCGAAAAAGGCAATATGATC
ATCCTCCCATCTTCAGCTGCCAGATATATTTTGAGCCAGAGCTCCCAAAATCCAATGCTC
TTCAAAATCACAAACCAACAACTAAACATCAGTTCTAATTGTGGAGTCCTTGAATTTACT
GCTGAGGAAGGATATTGTTTACTTCCATATTGGCTAATGCAACATTTAGGATTATCAGAA
GGAGGGGATGTGCTTATTGAAAGTGTTACTCTACCTAAAGGAACTTTTGTAAAGATTCAG
CCTCATGAAACAGCTTTTATAGACTTACCAAACCCAAAGGCTGTATTAGAAAATGGCTTA
AGAAATTACTTGTGTTTAACTAAAGGAGACTCTATTGTTATTGAATTTGCTAAAAAAAGA
TATGGAATTGATATTATTGAAACAAGACCAGCTAATGCTATTATGACAATTCAAACTGAT
TTACAAGTAGATTTTGCCCCACCTAAAGATTATAAAGAGGAACCTGTTTTGAAAAAAGAA
CCTTCGATTACTTTTGGAAAAGAAGAACAGAAAACAAGATCAGGGAATAAGACGATTACA
GGATATACTCTTGAAGGGAAAAAAGTTGAATTTACTTCTGGGAATAAAGATGATGAAGAA
AGAGAATATGATCCAAGACAACATAGAATTCCTAATGGGATTAAAAATGCACCGGTTATT
GTCAATCCAAATTATTGGGATAGCATGAAAGGTGGTAGGAAGTTAAATTAG