Identifiers and Description

Gene Model Identifier

SteCoe_1721

Standard Name

None

Aliases

None

Description

ER_lumen_recept domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16185.0.g843.873997628687187e-21ER lumen protein retaining rec
eptor

Tetrahymena ThermophilaTTHERM_009976201.0530617357553812e-20Putative ER-retrevial receptor
; transcription of TER1 induce
d following exocytosis; may be
cargo protein of dense core s
ecretory granules

WormBaseWBGene000161950.000045399929762484854

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1721(Protein)
MEIVLWLFTIGYFFQLGASGILIYKIWKQRSINGLCWDTQVIFFLGSFSRCLWLNETRLR
NLPLAHFELYCNTILLLICVYLCYKFRYTAIHSAPKYLKWYSVVFCCIILSFFFHPGNKN
KYYLSMQMLVSFTMFSESAGLLPQFAVMRKSKEIEAMTSKYIVNLGVARLFRLIFWLQMY
WSGDTFYSLIVADFIHTFILADFSLIYFKSLKSGKKLVLP


>SteCoe_1721(CDS)
ATGGAAATCGTGTTATGGCTCTTTACAATAGGGTACTTTTTTCAACTTGGAGCCTCGGGT
ATACTCATATACAAAATCTGGAAACAGAGATCAATAAATGGCCTTTGCTGGGACACCCAG
GTTATATTTTTTTTAGGAAGTTTTTCTCGGTGTCTCTGGTTAAATGAAACCAGACTAAGA
AACTTGCCATTGGCGCATTTTGAACTATACTGTAACACAATATTACTTTTAATCTGTGTT
TATTTATGTTACAAGTTTAGATATACAGCTATTCACTCAGCACCAAAATACTTGAAATGG
TATTCTGTAGTTTTTTGTTGTATAATCCTTTCTTTTTTCTTCCACCCAGGGAATAAAAAC
AAATATTATCTTTCAATGCAAATGCTCGTAAGTTTTACTATGTTTTCTGAAAGTGCAGGA
CTTTTACCACAATTTGCTGTAATGAGGAAATCTAAAGAAATTGAAGCTATGACTAGTAAA
TACATCGTAAATTTAGGTGTTGCTCGGCTTTTTAGGTTAATATTCTGGCTTCAAATGTAT
TGGAGTGGGGACACATTTTATTCTCTTATAGTAGCAGATTTTATTCATACGTTTATCCTT
GCAGACTTCTCGTTGATTTACTTTAAAAGCCTTAAATCTGGTAAGAAATTAGTATTACCT
TAA