Identifiers and Description

Gene Model Identifier

SteCoe_17270

Standard Name

None

Aliases

None

Description

Autophagy_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10290.0.g214.0795586671775603e-41Autophagocytosis associated pr
otein (Atg3), N-terminal domai
n

Tetrahymena ThermophilaTTHERM_010506201.7587922024243116e-25Autophagocytosis associated pr
otein, C-terminal domain conta
ining protein
Saccharomyces CerevisiaeYNR007C1.1548224173015786e-17E2-like enzyme; involved in au
tophagy and the cytoplasm-to-v
acuole targeting (Cvt) pathway
; plays a role in formation of
Atg8p-phosphatidylethanolamin
e conjugates, which are involv
ed in membrane dynamics during
autophagy and Cvt; interactio
n with Atg8p is regulated by i
ts acetylation by Esa1p (catal
ytic subunit of NuA4 histone a
cetyltransferase complex) whil
e attenuation of Atg3 acetylat
ion is mediated by histone dea
cetylase Rpd3p
WormBaseWBGene000219223.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17270(Protein)
MENLGHKIGNMYRNVAKKFKSVPTESAFLEKGTLTPQEFVVAGEQLVHRCPTWCWSTSTP
GNEQKHLPPENQYLITRGVPCRKRVRNIEDSEVTEKEIDGGWVVAESHKVEENIEEIIIK
GRDEVVEEDEEILDMEEVKESLIDENAVNIFSQDGYFKAEEPEDVIIKTRVYDLSVTYDL
YYQTPRLWLVGYDENRNLLTPEQMYEDIMEDYAKKTATIETHPCLGTPQISIHPCNHAKM
MKHFIDILASNNSVAQVHQAIFIFLKFLSSVVPTIEYDFTVDLSLE


>SteCoe_17270(CDS)
ATGGAGAATTTAGGACATAAGATTGGGAACATGTATAGAAACGTAGCTAAGAAGTTCAAA
TCTGTGCCAACTGAGTCTGCATTTCTAGAAAAAGGAACATTAACACCTCAAGAGTTTGTA
GTAGCCGGTGAGCAACTTGTCCATCGATGCCCGACATGGTGTTGGTCTACAAGTACACCA
GGGAATGAACAAAAACATTTACCCCCAGAAAACCAATACTTAATAACAAGAGGAGTGCCT
TGTAGAAAACGAGTTAGAAATATTGAAGACTCTGAAGTGACTGAGAAAGAAATAGATGGA
GGTTGGGTTGTTGCAGAAAGTCACAAAGTTGAAGAGAATATCGAAGAAATTATCATAAAA
GGAAGAGATGAAGTTGTCGAAGAAGATGAAGAAATTCTTGATATGGAAGAAGTCAAAGAA
AGTTTAATCGACGAAAATGCTGTAAACATTTTTTCTCAAGATGGTTATTTTAAAGCTGAA
GAGCCTGAAGATGTTATAATCAAAACAAGAGTTTATGATTTATCAGTAACTTATGATCTA
TATTATCAGACTCCAAGGCTTTGGCTTGTTGGCTATGATGAAAATAGGAATCTTTTGACT
CCTGAGCAAATGTATGAAGATATTATGGAAGACTATGCGAAAAAAACTGCGACAATTGAA
ACACACCCATGCTTGGGAACGCCTCAGATTTCAATCCACCCTTGTAACCATGCAAAAATG
ATGAAGCATTTTATTGATATTTTAGCTTCAAATAACTCAGTTGCTCAGGTGCATCAGGCA
ATTTTCATCTTCCTTAAATTCCTTTCATCAGTTGTCCCTACAATCGAATACGATTTTACG
GTTGATCTTAGTTTAGAGTAA