Identifiers and Description

Gene Model Identifier

SteCoe_17283

Standard Name

None

Aliases

None

Description

RNA_pol_Rpb6 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYPR187W2.3195228302435696e-16RNA polymerase subunit ABC23;
common to RNA polymerases I, I
I, and III; part of central co
re; similar to bacterial omega
subunit
Oxytricha TrifallaxContig8949.0.g1066.305116760146989e-16RNA polymerase Rpb6

WormBaseWBGene000073550.000000000000004658886145103398
Tetrahymena ThermophilaTTHERM_004211700.00000000000003442477108469977Subunit shared in RNA polymera
ses I, II & III

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17283(Protein)
MSSEEEYQSSPGEVEDDEEMEAMQEVDPDRPHASGEGRHSEEYVDEHDDHERTHTAENKE
KISTPYMTKYERARILGTRAMQISRNAPVFVELEPHETDPLLIAEKELREKKIPFIIRRY
LPDGTYEDWPISDLIIE


>SteCoe_17283(CDS)
ATGTCATCTGAAGAAGAATATCAGAGCTCTCCTGGTGAAGTAGAGGACGATGAGGAAATG
GAAGCTATGCAAGAAGTTGACCCTGACCGACCACATGCTTCAGGAGAAGGCCGCCATAGT
GAAGAGTATGTTGATGAACATGATGATCATGAGCGAACACATACGGCTGAGAATAAAGAA
AAAATATCAACACCATACATGACTAAATATGAGAGAGCAAGAATTCTTGGCACAAGGGCA
ATGCAAATAAGTAGAAATGCTCCAGTATTTGTAGAACTTGAACCTCATGAGACTGACCCA
TTACTTATTGCTGAGAAAGAATTACGTGAGAAAAAAATACCCTTTATCATTAGAAGATAT
TTGCCTGATGGCACTTATGAAGATTGGCCGATTTCTGACCTTATTATAGAATAA