Identifiers and Description

Gene Model Identifier

SteCoe_1742

Standard Name

None

Aliases

None

Description

IKI3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21547.0.g842.9374821117108028e-30IKI3 family

Tetrahymena ThermophilaTTHERM_000240508.75651076269652e-27RNA polymerase II elongator co
mplex subunit
Saccharomyces CerevisiaeYLR384C1.2995814250075031e-24Subunit of Elongator complex;
Elongator is required for modi
fication of wobble nucleosides
in tRNA; maintains structural
integrity of Elongator; homol
og of human IKAP, mutations in
which cause familial dysauton
omia (FD)
WormBaseWBGene000224630.0000000007582560427911907

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1742(Protein)
MENLWQVSQESWEVTGDFTCDSDKIYVLSSNTELKIIEGPAIVTHTLDISIDNLVEMTWL
QIEEKLIFITTSSIISYEPSSKDCINEGEMTCRISSARWSPNQELLALFLENGSLFLQNT
DLEVVKTIQTGLNHPASISWRNDSKFFQICGKYEDGYKVLTLDNKGNLLPSTVVSDKSGP
VQSVCDMNSLLSSPKISWHSSLIAGIHNNKIILWEKNGLKHEEFNTLNTPIDLSFNTDGK
ILAVFTNQGLELYIKNNYKWYLKQFFSLCSKFSWGEDFLIIQGKKLEKIMLYTSFNINQD
KVVVIDGLNIHLTDFSKGILPPPMSHAIYKISSPVKALWVGIDEIFIVNDKVIEIIKGHE
KFVGTVDLICKIDDKIYASVMNKLYEILEKQLVLIEEYDRNIGKLVQYKQKPMVELDDGR
VYVNEEMISKFPCFCPSFGVLELGKGPEIVGLASNTLYFGTKAWTSGCTSLLIQNSFLFF
TKKNAPYDVLYIFHFSDLPWEKPLPDPSNEHFYSRSIEKTCLIVSQGTLALVLQHSRGNL
EGISPRLLTLHQVRTLIHQQKYEESFKLLRKHKIDLNLLYDIDPDKFNIPLFISSIKKQE
YFNLFLTSLKDTDSVNKYFHTQTRNFEGKTNKISEEFRKHLNPESHSLSILTTFAIKTPA
EIDKALQWVQELKKNSPAKYHRAPHENSDEHGHKNHPEDAIKYLSWLVNPEKLYNVALGM
YDLELTSDLAKYTQKDPKEYLPYLNSLKNLSEVQMKYQINMDLKNHSKALEELVQGGLEY
RDQALSLIKTHKLYHKGLQLLQGKDVLLTVAESLTNSDYPLQAAALFEACEEYYKARDLY
ANCEEWELAVKMGKLINEDLTETWSHKCAELGRFESAAFLSQNSDDEHLLIKYWVQAGKY
KQAAICCKTKEGKDLLKSTLKNYANDLIGDLDKNFKTWTEKKTRLEFVQQNKRLMPESNK
ILNDETASMYSMDSSMSKMTQFSKKQKKKNRKIRKTAAKEGSMYEEDYLVDLLVTLRPDI
AYLEKVENLCIGLIVVGEILIALELFRKVEEVKNVTYKPISTLKQQEFVGKFFESFPEVT
RNEENESRLKDMFEKSTFLADGLASHKLPNFSSKLQGFFKAFA


>SteCoe_1742(CDS)
ATGGAAAATCTTTGGCAAGTTTCTCAAGAAAGTTGGGAAGTTACTGGAGATTTTACTTGT
GACAGTGATAAAATATATGTCCTAAGTTCAAACACTGAGCTCAAAATCATCGAAGGTCCA
GCAATAGTAACACACACCCTAGACATTAGCATTGATAATCTAGTTGAAATGACCTGGTTA
CAAATAGAAGAAAAACTTATCTTCATAACAACCTCAAGCATCATCAGCTACGAGCCATCA
TCAAAAGATTGTATAAACGAAGGGGAAATGACCTGCCGGATCTCATCAGCCAGATGGTCT
CCAAACCAAGAACTCTTAGCTTTATTCTTAGAAAACGGGAGTTTATTCCTTCAAAACACA
GATCTTGAAGTAGTTAAAACAATACAAACAGGTTTAAACCATCCAGCAAGTATATCTTGG
AGAAATGACTCAAAATTCTTCCAAATCTGTGGCAAATATGAAGATGGGTATAAAGTTCTT
ACCTTAGATAATAAAGGCAATCTACTCCCAAGTACTGTGGTTTCTGACAAATCAGGCCCA
GTTCAAAGTGTTTGTGACATGAACTCTCTTTTATCCTCTCCAAAAATCTCCTGGCATAGC
AGTCTTATAGCAGGTATTCATAATAACAAAATAATTCTCTGGGAAAAAAATGGCCTTAAA
CACGAAGAGTTCAACACTTTAAACACGCCAATCGACTTAAGTTTCAACACAGACGGTAAA
ATCCTAGCTGTTTTCACAAACCAAGGTCTTGAACTATATATCAAAAACAATTACAAATGG
TATTTAAAACAGTTCTTTTCACTATGTTCTAAATTCTCTTGGGGTGAAGACTTTCTAATT
ATCCAAGGTAAAAAGTTAGAAAAAATTATGCTTTACACCTCATTTAATATCAATCAAGAT
AAAGTTGTAGTAATCGATGGGCTAAATATTCATTTAACTGATTTTTCTAAAGGTATCCTT
CCACCTCCTATGAGTCATGCTATATACAAAATTTCAAGTCCAGTAAAAGCACTATGGGTT
GGTATTGATGAAATTTTTATAGTCAATGATAAGGTTATAGAAATAATAAAAGGTCATGAG
AAATTTGTTGGAACTGTTGATCTTATTTGTAAAATTGATGATAAAATATACGCAAGTGTT
ATGAATAAATTATATGAAATTTTAGAAAAACAGTTGGTTTTAATTGAGGAGTATGATAGG
AATATAGGGAAATTAGTTCAGTATAAACAAAAACCGATGGTAGAACTTGATGATGGTAGG
GTTTATGTGAATGAGGAAATGATCTCGAAGTTCCCTTGTTTTTGTCCTAGTTTTGGGGTT
TTGGAACTAGGAAAAGGTCCTGAGATTGTTGGTTTAGCATCAAATACCTTGTATTTTGGC
ACTAAGGCTTGGACTTCAGGGTGTACAAGTTTGTTAATCCAGAATAGTTTCTTGTTTTTC
ACTAAGAAAAACGCCCCTTACGATGTTTTGTATATATTCCACTTTAGTGATTTACCTTGG
GAGAAACCTTTACCTGACCCTAGCAATGAACATTTCTATAGCCGAAGCATTGAAAAAACA
TGCCTTATAGTCAGTCAGGGTACTTTAGCTCTTGTCCTTCAGCACTCCAGAGGTAACCTT
GAAGGAATCTCCCCCCGTTTATTAACTTTACATCAAGTCCGAACTTTAATCCATCAACAA
AAATATGAAGAATCCTTCAAACTTCTTAGAAAACACAAAATCGACCTCAACCTGCTTTAT
GATATCGATCCAGACAAATTCAATATCCCTCTTTTCATATCCTCTATAAAAAAGCAAGAA
TACTTCAATCTTTTTCTCACATCACTCAAAGATACAGACTCAGTAAATAAATACTTCCAT
ACACAAACTCGAAACTTTGAAGGCAAAACAAATAAAATAAGTGAGGAGTTCAGAAAACAT
CTAAACCCAGAGTCTCATAGTCTATCAATCCTAACAACTTTCGCTATAAAAACCCCTGCA
GAAATTGATAAAGCTTTACAATGGGTTCAAGAGCTTAAAAAAAACTCTCCAGCTAAATAT
CATAGAGCTCCACATGAAAACTCAGATGAACATGGGCATAAAAACCACCCTGAAGATGCT
ATAAAATACCTAAGTTGGCTTGTAAACCCTGAAAAACTCTACAATGTTGCATTAGGAATG
TATGATTTAGAACTCACAAGTGATTTAGCTAAATACACACAAAAAGACCCTAAAGAATAT
CTACCTTATCTAAACTCTTTAAAAAATTTATCAGAAGTTCAAATGAAATATCAAATTAAT
ATGGATTTAAAAAACCACTCAAAAGCTTTAGAAGAACTTGTCCAAGGAGGACTTGAATAT
AGAGATCAAGCTTTATCACTAATTAAAACCCATAAACTTTATCATAAAGGTCTTCAATTA
TTACAAGGAAAAGATGTATTATTAACAGTAGCTGAATCTTTAACTAATAGTGATTATCCT
TTACAAGCTGCAGCACTTTTTGAAGCATGTGAAGAATATTATAAAGCACGAGATCTTTAT
GCAAATTGTGAAGAATGGGAACTTGCTGTAAAAATGGGTAAACTTATAAATGAAGATTTA
ACTGAAACATGGAGCCATAAATGTGCAGAATTAGGGAGATTTGAAAGTGCTGCTTTTTTA
TCACAAAATTCTGATGATGAACATTTGCTTATAAAATACTGGGTCCAAGCTGGGAAATAT
AAACAAGCGGCGATATGTTGTAAGACTAAAGAAGGTAAAGATTTATTAAAAAGTACTTTG
AAGAATTATGCTAATGATTTGATTGGAGATTTAGATAAAAACTTTAAAACTTGGACTGAG
AAAAAAACTAGACTTGAGTTTGTTCAGCAGAATAAACGACTTATGCCAGAAAGCAATAAA
ATTTTAAATGATGAAACTGCTTCTATGTATAGTATGGATAGTTCTATGTCGAAAATGACT
CAGTTTAGTAAGAAACAGAAGAAAAAAAATAGGAAAATTAGAAAAACTGCTGCTAAAGAA
GGGTCGATGTATGAAGAAGATTATCTTGTTGATTTACTTGTGACATTACGTCCGGATATT
GCTTATTTGGAAAAAGTTGAGAATTTATGTATTGGGTTGATTGTTGTTGGGGAGATACTT
ATTGCGTTAGAACTTTTTAGGAAGGTTGAAGAAGTTAAAAATGTTACTTATAAGCCGATT
AGTACTTTAAAACAGCAGGAGTTTGTGGGGAAGTTTTTTGAAAGTTTTCCTGAGGTGACG
AGAAATGAAGAAAATGAAAGCAGGTTGAAGGATATGTTTGAAAAAAGCACGTTTTTGGCG
GATGGGCTGGCATCGCATAAATTACCGAATTTTTCTTCGAAGCTTCAAGGGTTTTTCAAA
GCTTTTGCCTAG