Identifiers and Description

Gene Model Identifier

SteCoe_1745

Standard Name

None

Aliases

None

Description

Peptidase_S24 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000218444.359610000063081e-28
Oxytricha TrifallaxContig19588.0.1.g531.185064864233981e-27Peptidase S24-like

Tetrahymena ThermophilaTTHERM_010935603.221340285992516e-27signal peptidase I family prot
ein; SECretory
Saccharomyces CerevisiaeYIR022W4.248354255291589e-1818kDa catalytic subunit of the
Signal Peptidase Complex (SPC
); the Signal Peptidase Comple
x cleaves the signal sequence
of proteins targeted to the en
doplasmic reticulum; other mem
bers are Spc1p, Spc2p, Spc3p,
and Sec11p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_1745(Protein)
MHALTDTWHEFKTMNKRRRALQAINLLLVISTALMTWKFFMVASWSESPIVVVLSGSMEP
AYYRGDILFLELTYNPPMSVGDVVVYKLGDRDIPIVHRIISVHEEKDELYMLTKGDNNRV
NDRGLYSQGQFWITRKDLMGRVWFYIPYVGIITIWLNDYPPLKYALISFMVIVGLTSREP
QG


>SteCoe_1745(CDS)
ATGCACGCCCTAACAGATACATGGCATGAGTTCAAGACAATGAATAAACGTCGGCGTGCT
CTTCAAGCAATAAACCTCCTTCTAGTAATCTCAACCGCCTTAATGACTTGGAAATTTTTC
ATGGTAGCTTCATGGAGCGAAAGTCCAATTGTCGTTGTTTTAAGTGGTTCAATGGAGCCA
GCATATTACCGAGGGGATATATTGTTTTTAGAGCTTACCTACAATCCTCCAATGTCAGTT
GGTGATGTTGTTGTTTACAAACTAGGAGATAGGGATATTCCAATTGTCCATAGGATAATA
AGTGTCCATGAAGAAAAAGATGAGCTTTATATGTTAACAAAAGGTGATAATAATCGAGTT
AATGACCGAGGATTGTATTCTCAAGGACAATTTTGGATAACTCGTAAAGATTTAATGGGT
CGAGTATGGTTTTATATACCCTATGTTGGGATTATAACAATCTGGCTTAATGATTACCCA
CCACTAAAATATGCACTTATAAGCTTTATGGTGATTGTTGGACTTACATCAAGAGAACCT
CAAGGTTAA