Identifiers and Description

Gene Model Identifier

SteCoe_17463

Standard Name

None

Aliases

None

Description

HSP70 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10574.0.g670Hsp70 protein

WormBaseWBGene000020070

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17463(Protein)
MSHKSSSTGVLYFSAIAICLMFLASGASKDYKLDGPAVGIDLGTTYSCVGIYRNGRVEII
PNDQGNRITPSYVAYTEDGERLVGESAKNQAAINPTNTAYSVKRLIGRKYNEDTVQHDKK
LLPYDIINKDGKPYIRLSVGGDRRDFAPEEISSMVLGKMRDIAEAFLGQEVKHAVITVPA
YFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKGQGEKNILVFDLGGGTFDVS
LLTIDNGVFEVVATSGDTHLGGEDFDQRTMEYLIKLFKKKTDKDVTNDKHAVQKLKREVE
NAKRALSSVHQVTIEIEAFHDGIDFSETLTRAKFEDLNNDLFKKTLAPVKQVLDDADMQK
SDIDEIVLVGGSTRIPKVQRLIKDFFNGKEPNMGINPDEAVAYGAAVQAGILSGEGSEEI
QDIVLVDVAPLSLGIETVGGVMTVLIPRGTVIPTKKSQVFSTYQDHQTMVSIQVYEGERS
MTKDNHKLGQFDLKDIPPAARGVPQIEVTFEIDSNGILSVSAVDQGTGNKNHITITNDTG
RLSKAEIERMIREAEEFAEQDKEAKAVVDARNALESYAYSMKNSIEDSEKLADKLSESDK
ETIKEAVDDAVSWLSSNTDASKEAYQDKLKEIEKICNPIVSKVYKGAEDSYDGEHDEL


>SteCoe_17463(CDS)
ATGTCGCATAAGAGTAGTAGTACAGGTGTCCTGTATTTTAGTGCAATAGCGATTTGTCTT
ATGTTTTTGGCCTCTGGAGCCTCAAAAGATTATAAACTTGACGGTCCTGCTGTAGGTATT
GACCTTGGAACCACCTATTCATGTGTTGGTATCTATCGTAATGGCCGTGTTGAAATCATC
CCTAATGACCAAGGCAACCGTATCACTCCTTCTTATGTTGCATACACCGAAGATGGTGAA
AGACTTGTAGGTGAATCAGCTAAAAATCAAGCTGCTATCAACCCAACTAATACTGCATAT
TCAGTTAAAAGATTGATTGGACGTAAATATAATGAAGATACTGTTCAACATGATAAGAAA
CTCCTACCTTATGATATTATTAACAAGGATGGCAAACCATACATTCGACTTTCTGTTGGA
GGTGACAGACGTGATTTCGCCCCTGAAGAAATCAGTTCTATGGTCCTTGGCAAAATGCGT
GACATCGCTGAAGCCTTTTTAGGTCAAGAAGTTAAGCATGCAGTTATCACAGTCCCTGCA
TACTTCAATGACTCTCAACGTCAAGCAACCAAAGATGCTGGAGCTATCTCAGGCTTAAAC
GTCCTCCGTATTATCAATGAGCCAACAGCCGCAGCCATAGCCTATGGTCTTGACAAAAAA
GGTCAAGGTGAGAAAAACATCCTCGTTTTTGACTTAGGTGGTGGGACATTTGATGTTAGC
CTTCTAACAATTGACAATGGTGTATTCGAAGTTGTGGCAACATCAGGAGATACTCACTTA
GGTGGTGAAGATTTTGATCAAAGAACCATGGAATATCTCATCAAACTCTTCAAAAAGAAA
ACTGACAAAGATGTGACAAACGATAAACATGCAGTTCAAAAACTTAAAAGAGAAGTTGAA
AACGCTAAAAGAGCTCTTTCATCAGTTCATCAAGTTACAATTGAAATTGAAGCTTTCCAT
GATGGCATTGATTTCAGTGAAACATTGACCAGAGCTAAATTTGAAGACTTAAACAATGAC
TTGTTCAAGAAAACCTTAGCCCCAGTGAAGCAAGTTCTTGATGATGCTGATATGCAAAAA
AGTGATATTGATGAAATTGTCTTAGTCGGTGGGTCAACTCGTATTCCTAAAGTCCAAAGA
CTTATTAAAGACTTCTTCAATGGAAAAGAGCCAAATATGGGAATTAACCCAGATGAAGCT
GTGGCTTATGGTGCTGCAGTCCAAGCAGGTATTCTTTCAGGTGAAGGATCAGAAGAAATC
CAAGATATTGTCCTTGTTGATGTCGCCCCATTGAGTTTGGGTATTGAAACTGTTGGAGGT
GTTATGACCGTCCTTATCCCTCGTGGTACTGTGATCCCAACAAAGAAATCTCAGGTATTC
TCAACTTATCAAGATCATCAAACTATGGTTTCAATTCAAGTTTATGAAGGAGAAAGATCA
ATGACTAAAGATAACCATAAACTAGGGCAATTTGATCTTAAAGATATCCCACCAGCAGCA
AGAGGTGTACCTCAAATTGAAGTAACATTTGAAATCGATTCAAATGGTATTCTTAGTGTA
TCAGCAGTAGACCAAGGTACTGGTAACAAAAACCATATCACAATTACAAATGATACTGGA
AGATTAAGCAAAGCTGAAATTGAAAGGATGATCAGAGAAGCTGAAGAATTCGCTGAACAA
GACAAAGAAGCTAAAGCAGTAGTTGATGCCAGAAACGCCTTAGAATCATATGCTTATTCA
ATGAAAAACTCTATTGAAGACTCTGAGAAACTAGCCGATAAGCTTAGTGAAAGCGATAAA
GAGACTATTAAAGAAGCTGTTGATGATGCAGTTTCTTGGTTAAGTTCTAATACTGATGCA
AGCAAAGAAGCATATCAAGATAAGCTAAAAGAAATAGAAAAAATCTGCAACCCAATAGTT
TCTAAAGTCTACAAAGGGGCTGAAGACTCTTATGATGGTGAGCATGATGAACTTTAA