Identifiers and Description

Gene Model Identifier

SteCoe_17466

Standard Name

None

Aliases

None

Description

Rad51 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig4225.0.0.g492.3455513385429143e-59Rad51

Tetrahymena ThermophilaTTHERM_001423303.4811068399043105e-57DNA repair protein RAD51 conta
ining protein; Strand exchange
protein; involved in homologo
us recombination and repair of
double-stranded DNA breaks
Saccharomyces CerevisiaeYER179W5.166420632837861e-55Meiosis-specific recombinase r
equired for repair of double-s
trand breaks; also required fo
r pairing between homologous c
hromosomes; homolog of Rad51p
and the bacterial RecA protein
; binds ssDNA and dsDNA, forms
helical filaments; stimulated
by Rdh54p
WormBaseWBGene000042979.221146422925876e-47

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17466(Protein)
MQVEEEEYVPCFSEVDKLQNYGINAADLTKLKSAGLCTVLGVLMTTKKDLISIKGLSEAK
VEKILEAAQKHESASFMTGIELQGKRQQVFRLTTGSSALDNLLGGGIESSAITEAFGEFR
SGKTQIALTLCITAQMPKTSGGGMGKVAYIDTEGTFRPERIAQIASRFNLNPEAVLENIL
YARAYTVEHQFQLLTLIAAKMTEEPFALLVVDSIMALFRVDYSGRGELSERQQVLGKMLS
RIMKISEQYNIVVYITNQVMADPGGGVSFVPDPKKPIGGHVLAHASTTRLYLRKGRGEQR
ICKIFDSPCLPEGEATFQIGPGGVEEASE


>SteCoe_17466(CDS)
ATGCAAGTTGAAGAAGAAGAATATGTTCCTTGCTTCAGTGAGGTGGATAAACTGCAAAAC
TATGGGATTAATGCTGCTGATTTGACTAAACTTAAATCTGCAGGACTTTGTACTGTACTT
GGGGTACTTATGACTACGAAAAAGGATTTAATATCAATTAAAGGACTCTCTGAAGCTAAA
GTTGAAAAGATTCTTGAGGCTGCACAAAAGCATGAATCAGCAAGCTTTATGACTGGTATC
GAACTCCAAGGTAAACGCCAGCAAGTCTTCAGGCTTACAACAGGGTCATCGGCTCTTGAC
AATCTTCTAGGCGGGGGTATTGAATCCTCAGCCATAACCGAAGCTTTTGGGGAATTTAGA
TCAGGTAAAACTCAAATCGCCCTAACTTTATGTATCACAGCCCAAATGCCTAAAACATCA
GGTGGAGGTATGGGTAAAGTAGCTTACATCGACACTGAAGGAACTTTTCGCCCAGAACGT
ATAGCCCAAATAGCATCAAGATTCAATCTAAATCCAGAAGCAGTACTTGAGAATATTCTC
TATGCAAGAGCTTATACAGTTGAACATCAATTTCAATTACTAACACTTATAGCTGCGAAA
ATGACTGAAGAACCATTTGCTTTACTTGTAGTAGATTCAATTATGGCCCTTTTTAGAGTT
GATTATTCAGGTAGAGGAGAATTAAGTGAAAGGCAGCAGGTATTAGGTAAAATGCTGAGT
AGGATAATGAAAATATCTGAGCAATATAATATTGTTGTTTACATCACAAATCAAGTTATG
GCTGACCCTGGTGGTGGAGTATCATTTGTCCCAGATCCAAAGAAACCAATAGGTGGGCAT
GTTTTAGCTCATGCAAGTACAACAAGATTGTATTTAAGGAAAGGTCGAGGTGAGCAAAGG
ATATGTAAAATATTTGATTCGCCATGCTTGCCTGAAGGAGAAGCTACTTTTCAAATAGGT
CCTGGAGGAGTAGAAGAAGCATCAGAATAG