Identifiers and Description

Gene Model Identifier

SteCoe_17483

Standard Name

None

Aliases

None

Description

UPF1_Zn_bind domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA) | GO:0000184

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17825.0.g1060RNA helicase (UPF2 interacting
domain)

WormBaseWBGene000048800

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17483(Protein)
MEPWAEVEEDSGEEITIEEEYNWDNLPEHACSYCGNHSPSTVVKCATENCNRWFCNSYGG
NKAGSHIIAHLVKARHKSVMMHSETTLGETNIECYVCSSKTVFLLGFVPSKTENTLIFLC
REPCALRNMISDKEWDLEAWKPLIEEKRFLPWIVSVPTEEEDRKARKISIKEISKIEEEI
RTGKVPVRTPEVSENIKHIKLRYNNTREYKEIYDKLVRLDAEYDREVKQSQKKNDINLRW
ERTDKRILAIFIFNKDDSDVRLVIGDEMKLSLESGKWEGIGTITRISDSEEVELQITTMK
GPIPNQVTDYSVEFVWKPTTFQRMQRGLQLLANRQIDAYILNKILGKNTENSMIKVNLPK
DLSAPNLPPLNHYQVEGVKKALASRLMLIQGPPGTGKTVTSATIVYHMVMQKKGQVLICA
PSNIAVDQLTEKLHKCGLKVVRVCAKSREAVSSTIDFLTLHQQVKDLDLADFSELKVLME
KREKIGILSSEEEDNFKKLRIKAENLILSKAEVISCTCSGSFDPRLKDFLFRQVLIDEAT
QATEPECLLPILTGACQVILVGDHCQLGPVVMCKKAAAAGYNRSLFERLVHLGNIPYRLH
IQYRMHPSIAEFSSITFYEGSLQNGVSISQRIYRGLDFPWPVPNKPLLFYNTIGPEELSA
SGTSYVNRTEAANVEKIVTQLMRSGVAGSQLGIITPYEGQRVFITAYLQNFGTLGPSHYR
EIEISSVDSFQGREKDFIILSCVRSNDNLGIGFLQDNRRLNVALTRAKFGLIICGNAKVL
AKQPLWNNLLNHYNEKGVLVEGALNNLKQCMIKLTPPQKLNFTNEAPYVEESNGFGTYIL
SAQQEFLDNL


>SteCoe_17483(CDS)
ATGGAGCCATGGGCAGAGGTTGAAGAAGACTCAGGTGAAGAAATCACAATCGAAGAAGAG
TACAACTGGGACAATCTTCCAGAACATGCTTGCTCATATTGTGGAAACCATAGCCCATCA
ACAGTAGTCAAATGTGCAACAGAAAATTGTAATCGCTGGTTTTGCAACTCTTACGGTGGC
AACAAAGCAGGTTCTCATATAATTGCCCATCTTGTTAAAGCCCGTCACAAATCTGTAATG
ATGCATTCTGAGACAACATTAGGCGAAACCAATATAGAATGTTATGTTTGTAGTTCAAAA
ACAGTCTTTTTACTTGGCTTTGTTCCATCAAAAACAGAAAACACACTGATTTTTTTATGT
CGTGAGCCTTGTGCTTTGCGAAATATGATCAGCGATAAAGAGTGGGATTTAGAGGCTTGG
AAGCCTTTAATTGAAGAAAAAAGATTCTTACCTTGGATTGTATCGGTACCAACAGAAGAA
GAAGACCGAAAAGCTAGGAAAATTTCAATAAAAGAAATAAGTAAGATTGAAGAGGAGATC
AGGACAGGCAAAGTCCCAGTCCGAACACCAGAGGTGTCTGAAAATATAAAGCACATAAAA
CTTAGGTATAACAATACAAGGGAATATAAGGAAATTTATGACAAACTTGTAAGATTGGAT
GCTGAGTACGACAGAGAAGTAAAGCAAAGCCAGAAGAAAAATGATATAAACTTGAGGTGG
GAAAGGACTGACAAGAGAATATTGGCAATTTTTATATTTAATAAAGACGATTCAGATGTT
CGCCTTGTTATAGGTGATGAGATGAAACTAAGTTTAGAAAGTGGTAAGTGGGAAGGCATT
GGGACAATAACCAGGATTAGTGATTCTGAGGAAGTTGAATTACAGATCACAACAATGAAA
GGACCAATCCCGAATCAAGTCACAGACTACTCTGTAGAGTTTGTCTGGAAACCAACAACT
TTTCAAAGAATGCAAAGAGGACTTCAACTACTAGCAAATAGACAAATTGATGCTTATATC
CTTAACAAAATCTTAGGAAAAAACACAGAAAACTCAATGATCAAAGTTAATTTGCCAAAA
GATCTTTCAGCACCTAACCTTCCACCACTTAATCATTATCAAGTTGAAGGGGTTAAAAAA
GCTTTAGCATCAAGGCTAATGCTTATACAAGGACCACCAGGTACAGGCAAAACAGTTACC
TCAGCAACAATTGTATATCATATGGTCATGCAGAAAAAAGGACAAGTACTAATATGTGCA
CCATCTAATATAGCTGTAGACCAATTAACTGAAAAACTTCATAAATGCGGATTGAAAGTT
GTAAGAGTCTGTGCAAAATCCCGTGAAGCTGTAAGTTCAACTATAGACTTTTTAACTTTG
CATCAGCAAGTTAAGGATTTAGATCTTGCTGACTTTTCTGAGCTGAAGGTGCTTATGGAG
AAACGGGAAAAAATAGGGATTTTATCTAGCGAGGAAGAAGATAATTTTAAAAAGCTCAGA
ATCAAAGCTGAAAACTTGATTTTATCTAAAGCTGAGGTCATCAGCTGCACTTGTTCAGGA
TCTTTTGACCCCAGGCTTAAAGATTTTCTTTTTCGACAGGTATTAATTGATGAAGCTACA
CAAGCAACAGAGCCTGAATGCTTGCTTCCAATACTTACTGGAGCTTGTCAAGTTATTTTA
GTAGGCGACCACTGCCAATTAGGCCCTGTGGTCATGTGTAAAAAAGCTGCTGCAGCTGGA
TATAATCGTTCTTTATTTGAACGTCTAGTTCATTTAGGTAATATCCCTTATCGGCTTCAT
ATACAATATCGTATGCATCCATCTATAGCCGAATTTTCTAGTATAACATTTTATGAAGGA
TCACTGCAAAATGGCGTGTCTATAAGCCAAAGGATTTATAGAGGACTTGACTTCCCATGG
CCGGTCCCTAATAAGCCTTTACTTTTCTATAATACTATTGGACCAGAAGAACTTTCAGCT
TCAGGAACTTCTTATGTTAATCGAACTGAGGCTGCTAATGTTGAAAAAATTGTCACGCAA
CTCATGAGATCTGGAGTTGCTGGAAGCCAATTGGGAATTATAACTCCTTATGAAGGACAA
AGAGTTTTTATTACTGCTTATTTACAAAATTTCGGTACTTTAGGACCTAGTCATTATAGG
GAAATTGAGATTTCATCTGTTGATAGTTTTCAAGGAAGAGAAAAAGATTTTATTATTTTA
AGCTGTGTTAGGTCTAATGATAACCTAGGCATTGGATTTTTGCAAGATAATAGAAGATTG
AATGTTGCTTTGACTAGGGCTAAATTTGGATTGATTATATGTGGAAATGCTAAGGTTTTA
GCAAAACAGCCGCTCTGGAATAATTTATTAAATCATTACAATGAGAAAGGAGTCCTTGTT
GAAGGGGCGTTGAATAATTTGAAGCAGTGTATGATTAAGTTGACACCACCACAGAAGTTA
AATTTTACAAATGAAGCGCCTTATGTTGAAGAGTCGAATGGATTTGGAACTTATATTTTG
AGTGCTCAGCAAGAGTTTTTGGATAACCTTTAG