Identifiers and Description

Gene Model Identifier

SteCoe_17518

Standard Name

None

Aliases

None

Description

XRN_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001452705.440559879258653e-75XRN 5'-3' exonuclease family p
rotein
WormBaseWBGene000069641.1379798735078682e-50
Oxytricha TrifallaxContig944.1.g41.368539471173853e-44XRN 5'-3' exonuclease N-termin
us

Saccharomyces CerevisiaeYOR048C1.5007857627073948e-41Nuclear 5' to 3' single-strand
ed RNA exonuclease; involved i
n RNA metabolism, including rR
NA and snRNA processing as wel
l as poly (A+) dependent and i
ndependent mRNA transcription
termination; required for cotr
anscriptional pre-rRNA cleavag
e

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17518(Protein)
MGVPTFFKWLSLRYPKSIVQSNSAQHELPNFDNLYLDMNGIIHPCCNPPEGDKPTSEEQM
FENIFKYVEELVNLVKPRNLIYLAIDGVAPRAKMNQQRARRYRKIQEERERPRAQTSDFR
FDSNVITPGTPFMYRLSEAIHKFVLKKLQTSWKNLQVIFSDSNNPGEGEHKILEFVRIQR
SLPNYNPNTKHVIFGADADLIMLSLITHEAHFYIIRESLIDFRTLYCKTCGQTGHFEQDC
ERIARSDQPSTSSKFQFIKVPVLRQYLFYEFKDLTKFPIFDFERIIDDFVFLCFFVGNDF
LPHLPSMHIRDGAIDGLIYLYGKIFPKLGGYLTENGKVVLYRVDMIMAEVGKIEEEYFKE
KEEREMFIRKRYEGSKKKNDIKEDNVGSSDNPIEVEDIIKLGQEGWKLRYYSEKFKVEGE
EVEEFRRRIHTSYMEGLSWVFEYYFQGCASWGWYFPFHYAPFASDLYNSASLRLKFEYGN
PFQPYAQLLSVLPAESCTALPIALRPLITEDISEISDFYPRDFHLDINGKRFAWQGVMLL
PFIEENRLLQALQEKISLLDIDDIERNSEGETFLYSNKEIPGVNMNFISKKPKFRMYTID
EGCTIRFDVVQNHVKGKHQSKKLDGVVDADLEVDESIFRAGDRRGFGASNMISMIAKNFA
MDPYNDKWRPQNRNFKVCEIVKNDPKPEKKPRAEPPQETLVDNIKKLVALLGGGKK


>SteCoe_17518(CDS)
ATGGGAGTGCCGACTTTTTTTAAATGGCTCAGTTTGAGGTATCCAAAATCCATAGTTCAA
TCCAACTCTGCCCAACATGAACTGCCGAATTTCGACAATCTTTATCTAGACATGAACGGG
ATTATACATCCTTGTTGTAATCCTCCTGAAGGTGACAAGCCTACATCCGAGGAGCAAATG
TTTGAAAACATCTTCAAATATGTCGAAGAACTGGTAAACCTAGTAAAACCTCGCAATCTC
ATCTACCTGGCAATTGATGGTGTAGCTCCAAGAGCCAAAATGAACCAACAGCGAGCTAGA
AGGTATCGAAAAATCCAAGAAGAGCGCGAAAGGCCTAGGGCACAAACATCAGATTTCAGA
TTCGATTCAAATGTCATAACCCCAGGAACACCATTTATGTACCGTTTAAGTGAAGCTATC
CACAAATTTGTCCTTAAAAAATTACAAACTTCTTGGAAAAATCTTCAAGTCATCTTTTCA
GACTCCAACAACCCAGGGGAAGGCGAACATAAAATTCTTGAATTTGTCAGAATACAAAGA
TCCTTGCCCAATTATAACCCAAACACAAAACACGTGATTTTTGGTGCTGATGCCGATCTG
ATAATGTTAAGTCTAATCACACATGAAGCACATTTTTATATAATCAGAGAAAGTTTGATT
GATTTTAGGACTTTGTATTGTAAAACATGTGGTCAAACAGGACATTTTGAACAGGATTGT
GAGAGGATTGCCCGGAGTGACCAGCCTTCAACATCTTCGAAATTCCAGTTTATAAAAGTT
CCAGTTTTAAGACAATACTTGTTTTATGAATTCAAAGATTTGACAAAATTCCCGATTTTC
GACTTTGAGCGTATTATTGACGATTTTGTGTTTTTATGTTTTTTTGTAGGTAATGATTTC
CTTCCTCATCTTCCATCAATGCATATTCGTGATGGGGCAATAGATGGTTTGATCTATTTA
TATGGTAAAATCTTCCCTAAACTTGGAGGTTATCTAACAGAAAACGGGAAAGTTGTTTTG
TATCGTGTTGATATGATCATGGCTGAAGTAGGGAAAATTGAAGAAGAATATTTCAAAGAA
AAAGAAGAACGAGAAATGTTTATAAGAAAAAGATATGAAGGGTCTAAAAAGAAAAATGAT
ATTAAAGAAGATAATGTTGGTAGTTCAGATAATCCAATTGAAGTTGAAGATATTATAAAA
TTAGGCCAAGAAGGATGGAAACTTAGATATTATTCAGAGAAATTCAAAGTTGAAGGTGAA
GAAGTTGAAGAGTTTAGAAGGAGGATTCATACAAGTTATATGGAAGGACTTAGCTGGGTA
TTTGAATATTATTTTCAAGGATGTGCATCATGGGGATGGTATTTTCCTTTCCATTATGCC
CCTTTTGCTTCTGATTTATACAACTCAGCAAGTTTAAGGTTGAAATTTGAATATGGAAAC
CCTTTTCAACCTTATGCCCAACTCCTTTCTGTCCTTCCAGCTGAAAGCTGTACTGCTTTA
CCTATAGCTTTAAGACCTTTGATCACTGAAGATATATCTGAAATAAGCGACTTTTATCCT
AGAGACTTCCACTTGGATATAAATGGCAAAAGGTTCGCTTGGCAAGGAGTCATGCTTTTA
CCTTTCATAGAAGAAAATAGGCTTTTACAAGCTTTACAAGAAAAAATCAGTTTATTAGAT
ATTGATGATATTGAAAGGAACTCAGAAGGGGAAACTTTTTTGTATTCTAATAAAGAAATA
CCTGGAGTTAATATGAATTTTATAAGCAAAAAACCTAAATTTAGGATGTATACAATTGAT
GAAGGGTGTACTATAAGATTTGATGTTGTGCAAAATCATGTTAAAGGAAAACATCAGAGT
AAAAAACTTGATGGGGTTGTTGATGCTGATTTAGAAGTTGATGAAAGTATTTTTAGAGCT
GGGGATCGAAGAGGTTTTGGTGCTAGTAATATGATTAGTATGATTGCTAAAAATTTTGCC
ATGGATCCATATAATGATAAATGGAGACCACAAAATAGAAATTTTAAGGTTTGCGAGATT
GTGAAGAACGACCCTAAGCCTGAAAAGAAACCTAGAGCTGAACCACCACAGGAGACGTTG
GTGGACAATATAAAGAAACTTGTTGCTTTGTTGGGTGGTGGGAAAAAGTAA