Identifiers and Description

Gene Model Identifier

SteCoe_17585

Standard Name

None

Aliases

None

Description

MutS_I domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig820.1.g1220MutS domain V

Tetrahymena ThermophilaTTHERM_004262301.7785284761271306e-68MutS domain III family protein
WormBaseWBGene000034225.166420632837861e-55
Saccharomyces CerevisiaeYDR097C8.408597124803643e-50Protein required for mismatch
repair in mitosis and meiosis;
forms a complex with Msh2p to
repair both single-base & ins
ertion-deletion mispairs; also
involved in interstrand cross
-link repair; potentially phos
phorylated by Cdc28p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17585(Protein)
MKNLFNYFTRESKQSSNTGPPTIVEKETPKTSVKKLEQSPTSTEAPKTCPASLIKKTKRN
DSDSFDEGDFDLPKFLKKSEIKDSNMRRPDDPDYDPTTLYIPPGQKFTPAMQQYWEIKKS
HFDKILLFKLGKFYELFYLDAITVQGILDLKWMGDEQKKAHVGFPEKTLEKNAAILIEKG
LKIVVVEQTETTVKNRVQKAGKVVGREITEILTKSTFSAHYMSSDHEPAYLLSVVEIQDN
FGIVLADLSTCEFFVGECNREDFRNLIYRSRPSEIVYNQYFLSGNTLKMIKALPIPPVFS
MIKNSDEWNPIKLSEYFPEDVPKIIASLPMHSSMRALVGCCYYLKNSLIFDRTIGIGQFK
VYQQDLIHQRYMNLDSQALEHLEILLANVGKEKVVKGSLYDFLNKCSTPFGKRLLKKWVT
SPLMSVESINKRLDAVTELISNKEVYKVFDKAASKLPDLERLLAKLSAYSIKSNSKAVYF
EDVGTNRLKEFCSFLKFMQSLQSLMSDIESFDLQSEGLVNIIKLQSYDGCFPDLNPLCNE
LFSKIQNNNGEPEPIEGFCDSYDDVKSEIKTLKNSLQNELLTERARFGNNPEIKFVDSKF
RYELEVPMYLVDKSKPKDYEETSGRNGFQRYYTKNIKSLADKLVVTEERLKNELKPFINQ
LMSLFYANFEIWKKAIDLVSEFDCLASLAKVVNSTAFTMSRPYFCSDSSEMEIQELVHPI
LASRVDNFIPNSVHFTEDNHCFVLTGPNMGGKSTILREIGLATIMAQIGSYVPAEYMKFS
PVDSIFTRLGASDSLIEGKSTFFVEMEEANKFFKKGTKNSLVIMDELGRGTSTEDGSALA
YAVLDALAESKPKTMFTTHYHMILIDIREIPGVVMTHMDSVLNATTKTLTFLYKLKNGEC
PKSYGLNIARLAGINENIIKVAEKKAAEEEYEQKLALVTGMLKKLKEKGIQNPMPYIQEI
LNEYNN


>SteCoe_17585(CDS)
ATGAAAAATCTTTTTAACTACTTTACCCGCGAATCCAAACAAAGTTCAAACACAGGACCT
CCAACTATAGTCGAAAAGGAAACACCTAAAACTAGTGTCAAAAAGCTTGAACAATCACCA
ACATCAACAGAAGCCCCAAAAACATGCCCTGCCTCATTAATAAAAAAAACAAAAAGAAAT
GATTCAGATTCTTTCGATGAAGGCGATTTCGATCTTCCCAAGTTTTTAAAAAAGAGCGAA
ATTAAAGATTCCAACATGAGAAGACCAGATGACCCCGACTACGACCCAACAACTCTTTAC
ATTCCCCCAGGTCAAAAATTTACCCCAGCAATGCAACAATACTGGGAAATAAAAAAAAGC
CACTTCGACAAAATCCTTCTTTTCAAACTTGGAAAATTTTACGAACTTTTCTATCTAGAC
GCAATAACCGTACAAGGAATCCTAGATTTAAAATGGATGGGTGACGAGCAGAAAAAAGCT
CATGTTGGCTTTCCTGAAAAAACACTTGAAAAAAATGCAGCTATTCTTATAGAAAAAGGG
CTAAAAATCGTTGTAGTCGAACAAACTGAAACAACTGTTAAAAACAGAGTCCAAAAAGCA
GGGAAAGTTGTAGGTAGGGAAATTACTGAAATTTTAACTAAATCAACATTTTCTGCTCAT
TACATGTCTTCTGATCATGAACCAGCTTATTTACTTTCTGTTGTGGAAATACAAGATAAT
TTTGGGATTGTATTAGCGGATTTATCAACATGTGAATTTTTTGTTGGTGAATGTAATAGG
GAAGATTTTAGGAATCTTATATATAGATCCAGACCTTCAGAGATTGTTTATAATCAATAT
TTTCTTTCAGGAAATACTTTGAAAATGATTAAGGCGCTACCTATTCCCCCAGTGTTTAGT
ATGATAAAAAACTCTGATGAGTGGAACCCAATCAAACTTTCTGAATATTTTCCTGAAGAT
GTACCTAAAATTATCGCCTCTTTACCTATGCATTCTTCTATGAGAGCACTTGTTGGGTGT
TGTTATTATCTTAAAAATTCTCTTATATTTGATAGGACTATTGGTATTGGCCAATTTAAA
GTTTATCAGCAAGATTTAATACATCAAAGATATATGAATTTAGATAGTCAAGCTTTAGAA
CATCTTGAAATTCTTCTGGCAAATGTAGGTAAAGAAAAAGTTGTTAAAGGTAGTCTATAT
GATTTCCTTAATAAATGTTCAACACCTTTTGGTAAAAGATTATTGAAAAAATGGGTAACT
TCGCCATTAATGTCAGTTGAGAGTATAAATAAAAGGCTTGATGCTGTAACAGAACTTATT
TCTAATAAAGAAGTTTATAAAGTTTTTGATAAAGCTGCATCTAAACTTCCAGATCTTGAA
AGGCTTTTAGCTAAATTATCGGCTTATAGTATAAAATCGAACTCAAAAGCAGTGTATTTT
GAGGATGTAGGTACAAATCGTCTAAAAGAATTCTGTAGTTTTCTTAAGTTCATGCAAAGT
TTGCAAAGCCTTATGAGCGATATAGAATCTTTCGACCTCCAATCAGAAGGTCTAGTCAAT
ATAATCAAACTTCAAAGCTATGATGGTTGTTTCCCTGATCTAAATCCTTTATGTAATGAA
TTGTTCTCTAAAATCCAAAACAACAATGGAGAGCCTGAGCCAATTGAAGGTTTTTGTGAC
TCATACGATGATGTGAAATCTGAAATAAAAACATTAAAAAACTCTCTTCAAAATGAACTT
TTAACTGAAAGGGCTAGGTTTGGAAACAACCCTGAAATAAAATTTGTAGATTCAAAATTC
AGATACGAACTCGAAGTGCCAATGTATTTAGTAGATAAATCAAAGCCTAAAGACTATGAA
GAAACTAGTGGGAGGAATGGTTTTCAGCGTTATTACACTAAAAATATCAAAAGTTTAGCT
GATAAGCTTGTCGTTACTGAAGAAAGGTTAAAAAACGAACTTAAGCCTTTTATAAACCAG
TTAATGAGTTTATTTTATGCGAATTTCGAGATATGGAAAAAAGCTATCGACCTGGTTTCT
GAATTCGACTGCTTAGCAAGTCTTGCGAAAGTTGTTAATAGCACAGCTTTTACTATGAGT
CGTCCTTATTTCTGTTCGGATTCATCAGAAATGGAAATTCAAGAATTAGTTCACCCAATA
CTCGCATCAAGGGTTGATAATTTTATTCCAAATAGTGTGCATTTTACTGAAGATAATCAT
TGTTTTGTACTTACTGGACCGAATATGGGTGGGAAATCAACGATACTTAGAGAAATTGGA
CTTGCGACAATAATGGCTCAAATAGGCAGTTATGTACCTGCTGAGTATATGAAATTCTCC
CCGGTTGACAGTATTTTTACTAGACTTGGAGCTAGTGATTCCCTTATAGAAGGTAAAAGT
ACGTTTTTTGTTGAAATGGAAGAAGCGAACAAGTTTTTTAAAAAAGGCACGAAAAACTCT
TTAGTCATTATGGATGAACTTGGACGAGGGACTTCAACTGAAGATGGTTCTGCATTAGCT
TATGCAGTTTTAGATGCATTGGCTGAGTCTAAGCCAAAGACAATGTTTACTACTCATTAT
CATATGATACTTATTGATATTAGAGAAATACCTGGTGTTGTTATGACCCATATGGATTCG
GTATTAAACGCAACTACTAAAACTTTAACTTTTCTTTACAAACTGAAAAATGGAGAATGT
CCAAAAAGCTATGGATTAAATATTGCAAGGCTAGCAGGGATTAATGAAAACATAATAAAA
GTTGCTGAGAAAAAAGCAGCAGAAGAGGAATACGAACAAAAACTAGCCCTTGTTACAGGA
ATGCTCAAAAAGCTTAAAGAAAAAGGTATTCAAAACCCTATGCCTTATATTCAAGAAATC
TTAAATGAATATAATAATTAA