Identifiers and Description

Gene Model Identifier

SteCoe_17804

Standard Name

None

Aliases

None

Description

DHFR_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003121203.665820411179563e-77bifunctional dihydrofolate red
uctase-thymidylate synthase
Oxytricha TrifallaxContig20294.0.g95.440559879258653e-75Thymidylate synthase

WormBaseWBGene000224559.462629465836378e-57
Saccharomyces CerevisiaeYOR074C7.667648073722e-53Thymidylate synthase; required
for de novo biosynthesis of p
yrimidine deoxyribonucleotides
; expression is induced at G1/
S

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17804(Protein)
MARDFALVVAISKNKGIGKNGKLPWEISADMKHFKQLTLTGLCENSVIMGRNTWESIPEK
FRPLAKRKNIVISSSLQSEKCIVVRTFEEALANASGNIFVIGGTQVFNQALSPELIQYCK
QIYITRIAQSIECDVFFPDPSPDIFHETFLSRFSLVKVSKTFVDKDLAYDFALYNNKNCL
ELADMTNYPEHEEYQYLALVKEIIDKGAKRDDRTKVGTFSVFGRMSRYSLSETFPIFTTK
LVFWKAVVEELLWFIRGSTNANELSAKGVHIWDANGSRDFLDKLGFNDREVGDLGPVYGF
QWRHFGAEYTNMNADYTNQGVDQLAEVIKLIKTDPDSRRIVMSAWNPKSQPFMALPPCHV
LCQFFVENGKLNCLMYQRSGDMGLGVPFNVASYSLLTCLIAQVCDLQRGDFVHVIGDTHV
YTNHIEPLKIQLTRHPHPFPVLKLNPSVKNIENFTFADIKLENYLKHAKIPMDMAV


>SteCoe_17804(CDS)
ATGGCGCGAGATTTTGCATTAGTTGTAGCTATATCAAAAAACAAAGGTATAGGTAAAAAC
GGTAAACTTCCTTGGGAAATTTCAGCTGATATGAAGCATTTTAAACAACTCACATTAACA
GGCTTATGTGAAAATTCTGTGATCATGGGTAGGAATACATGGGAATCAATACCTGAAAAA
TTTCGCCCTTTAGCCAAAAGAAAAAACATTGTCATCTCCTCATCTTTACAAAGCGAAAAA
TGTATTGTAGTAAGAACTTTTGAAGAAGCCTTAGCAAATGCATCAGGCAATATATTTGTT
ATTGGAGGTACTCAAGTATTTAATCAAGCTCTTTCACCAGAATTAATTCAGTATTGCAAA
CAAATTTATATAACAAGAATAGCTCAGTCCATAGAATGTGATGTTTTTTTCCCAGACCCA
TCGCCTGATATATTCCATGAAACATTTCTCTCAAGATTTTCTTTAGTAAAAGTTTCAAAA
ACATTTGTTGACAAGGATTTAGCATATGATTTCGCTTTATACAACAATAAAAATTGTTTA
GAATTAGCAGATATGACTAACTACCCTGAACATGAAGAATATCAATATTTAGCATTAGTA
AAAGAGATTATCGATAAAGGGGCAAAAAGGGATGATAGGACAAAAGTAGGGACTTTTAGT
GTTTTCGGGAGGATGAGTAGGTATAGTTTATCAGAAACTTTCCCAATATTTACAACAAAA
TTAGTGTTTTGGAAAGCAGTGGTTGAAGAACTCTTATGGTTTATTAGAGGAAGCACAAAT
GCTAATGAATTAAGTGCTAAAGGTGTCCATATCTGGGATGCAAATGGAAGTAGGGATTTC
TTAGATAAACTCGGCTTTAATGATAGAGAAGTTGGAGATCTAGGGCCAGTTTACGGTTTC
CAATGGAGACATTTTGGAGCTGAATATACTAATATGAATGCTGACTATACAAACCAAGGA
GTTGATCAGCTTGCAGAAGTTATTAAACTTATAAAAACAGATCCTGATTCACGTCGTATA
GTAATGAGTGCTTGGAATCCTAAATCTCAACCATTTATGGCTTTGCCTCCTTGCCATGTT
CTTTGCCAGTTTTTTGTAGAAAATGGAAAACTCAACTGCCTTATGTATCAGAGATCAGGC
GATATGGGTTTAGGCGTTCCTTTTAATGTTGCAAGCTACTCACTATTAACATGCTTAATT
GCTCAAGTTTGTGACTTACAAAGAGGTGACTTCGTTCATGTTATTGGAGATACTCATGTT
TATACAAACCATATTGAGCCACTTAAAATCCAATTAACTAGACATCCACACCCATTCCCA
GTCCTCAAACTTAACCCATCCGTTAAAAACATAGAAAACTTTACTTTTGCTGATATCAAA
CTTGAAAACTATCTCAAGCATGCCAAAATCCCAATGGACATGGCTGTTTAA