Identifiers and Description

Gene Model Identifier

SteCoe_17823

Standard Name

None

Aliases

None

Description

tRNA-synt_1e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16632.0.g723.665820411179563e-77tRNA synthetases class I (C) c
atalytic domain

Tetrahymena ThermophilaTTHERM_005600003.5722699376192174e-67cysteinyl-tRNA synthetase fami
ly protein
Saccharomyces CerevisiaeYNL247W5.166420632837861e-55Cysteinyl-tRNA synthetase; may
interact with ribosomes, base
d on co-purification experimen
ts
WormBaseWBGene000008003.817497188671175e-54

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17823(Protein)
MSGSWIRPKESTFRTGLKLFNTLTQSKEEFFTSSGDRRVYWYMCGPTVYCDTHMGHARTY
ITSDVIRRILTDYFGYQVTLCMNITDIDDKIINTSAKLSIPWDEFARNWEEKFFEDMEKV
NVRRPDILTRVSEYVPEIITYVDKIIQNNYAYVSNGSVYFDTEFFKKTHNYIKLEPSAQD
DVEAMQVAEGNTDVNSTEKKRIQDFALWKKSKAGEPFWQSPYGEGRPGWHIECSVMSSDV
LPCPIDIHSGGIDLRFPHHDNEIAQCEAYFECQQWVNYFLHTGHLHIHGRKMSRSLKNFI
TIKEILKEYTSRQLRMFFLLHKWDGTINYSETSLQESIGKEKQFKEFLMNTTAALRNLSL
KTPQKPNEEDRILLRSLENCRVKIHEALCDNLSTDRAIDELSILVNKSNIYLQGHPRYLV
LSNIRGYVLKTLEMFGLEYSEDNKTSDFDPLMDILSGYREKVRSAAREKNFAEIFKVSDL
IRDADLPKLGIILEDVGKEGSRWKKGNPDEIAIEIERKNKEEEKKRVQEEEKKKKQEEMR
LEKEAKMKIKAEEMFRDDPKYSQWDEKGIPTHYADGKPVSKSEGKKLIKLWEKQKALNSN


>SteCoe_17823(CDS)
ATGAGTGGTTCTTGGATCCGCCCAAAAGAAAGCACCTTCAGAACAGGTCTGAAACTATTC
AACACCCTTACCCAATCTAAAGAAGAATTCTTCACAAGCTCAGGTGATCGAAGAGTCTAT
TGGTACATGTGTGGGCCTACTGTATACTGTGACACTCACATGGGTCATGCGCGTACTTAC
ATAACTTCTGATGTTATCCGTCGTATATTAACCGACTACTTCGGTTATCAAGTAACTTTA
TGTATGAATATCACCGACATAGACGATAAAATAATCAACACTTCAGCCAAACTTAGTATC
CCTTGGGACGAATTCGCTAGAAATTGGGAAGAAAAGTTCTTTGAAGATATGGAAAAAGTC
AATGTCCGCCGTCCTGATATATTGACAAGAGTTAGTGAATATGTCCCTGAGATTATAACT
TATGTCGATAAGATCATTCAAAATAATTATGCTTATGTGTCAAATGGGTCAGTGTATTTT
GACACAGAATTTTTTAAAAAAACTCACAATTATATTAAATTAGAACCTTCAGCTCAGGAT
GATGTTGAAGCTATGCAGGTAGCTGAAGGGAATACTGATGTGAACTCGACTGAGAAAAAA
AGAATACAGGATTTCGCTTTGTGGAAGAAATCTAAAGCAGGAGAACCTTTTTGGCAGTCA
CCATATGGCGAAGGTCGTCCAGGTTGGCATATTGAGTGCTCGGTGATGTCTTCAGATGTA
TTACCTTGTCCTATTGATATACATTCAGGGGGAATTGATTTAAGATTTCCTCATCATGAT
AATGAGATTGCTCAATGTGAAGCTTATTTTGAATGCCAACAGTGGGTGAACTATTTCCTC
CATACAGGACATTTGCATATCCATGGAAGGAAAATGAGCAGGAGTCTTAAGAATTTCATC
ACAATCAAAGAAATCCTTAAAGAATACACGTCAAGACAGCTTAGGATGTTCTTTTTACTC
CACAAATGGGATGGGACAATCAACTACAGTGAAACTTCTCTACAAGAATCCATAGGCAAA
GAAAAACAGTTTAAAGAATTCTTGATGAATACAACTGCAGCCTTAAGGAATTTATCATTA
AAAACCCCACAAAAACCTAATGAAGAAGATCGAATTTTGCTTAGATCACTTGAAAACTGC
AGAGTTAAAATCCATGAAGCACTTTGTGACAATTTATCTACAGACCGAGCTATAGATGAA
TTATCAATATTGGTCAATAAATCTAATATATATTTACAAGGGCATCCAAGATATCTTGTT
CTTTCTAATATTAGAGGATATGTTCTTAAAACATTAGAGATGTTTGGTTTAGAATATTCT
GAGGATAATAAAACTAGTGATTTTGATCCACTTATGGATATACTTAGTGGATATAGAGAA
AAAGTTCGAAGCGCAGCAAGAGAGAAAAATTTCGCAGAAATTTTTAAAGTTAGTGATTTG
ATTAGGGATGCAGATTTGCCGAAACTTGGGATTATATTGGAAGATGTAGGTAAAGAAGGA
AGTAGATGGAAAAAAGGAAATCCTGATGAAATTGCTATTGAGATTGAGAGAAAAAATAAG
GAGGAAGAGAAGAAAAGGGTACAAGAGGAAGAGAAAAAGAAAAAACAGGAAGAAATGAGA
CTGGAAAAAGAGGCTAAGATGAAGATAAAAGCAGAAGAAATGTTTAGGGATGACCCTAAG
TACTCGCAGTGGGATGAAAAAGGCATACCGACACATTATGCTGATGGCAAACCAGTGAGC
AAGTCGGAAGGAAAAAAACTTATCAAGCTGTGGGAGAAACAAAAAGCCCTTAATAGTAAC
TAA