Identifiers and Description

Gene Model Identifier

SteCoe_17844

Standard Name

None

Aliases

None

Description

Ribosomal_L29 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYDL191W0.00000000000009357622968840175Ribosomal 60S subunit protein
L35A; homologous to mammalian
ribosomal protein L35 and bact
erial L29; RPL35A has a paralo
g, RPL35B, that arose from the
whole genome duplication
Tetrahymena ThermophilaTTHERM_005616800.0000000000002543665647376923Homolog of Yeast RPL35, Bacter
ial RPL29
Oxytricha TrifallaxContig1454.1.g210.0000000000002543665647376923Ribosomal L29 protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17844(Protein)
MVKVKASELRKKDQDQLKKQVEDLKTELSTLKVAKVAGGAPAKLAKIKVVRKSIATALTV
IHEKKLTQVRLDSKGKKYQPLDVRGKKTRAIRRRLTKKQENKLVLRVLKRKQNFPQRRFA
VAK


>SteCoe_17844(CDS)
ATGGTGAAAGTTAAAGCCTCTGAGCTTCGAAAGAAGGACCAAGACCAACTCAAGAAGCAA
GTGGAAGACTTAAAAACCGAACTTTCTACCCTCAAAGTAGCTAAAGTTGCAGGAGGTGCT
CCAGCTAAGCTCGCCAAGATTAAAGTGGTAAGAAAATCAATTGCTACAGCTCTAACTGTG
ATCCACGAAAAAAAACTGACTCAAGTAAGACTGGATAGCAAAGGAAAAAAATACCAACCA
CTTGATGTCAGAGGCAAGAAAACCAGGGCAATTCGCAGAAGACTTACAAAGAAACAAGAA
AACAAGTTAGTCCTTCGTGTTCTAAAGCGTAAACAAAACTTCCCTCAAAGAAGATTTGCT
GTGGCTAAGTAA