Identifiers and Description

Gene Model Identifier

SteCoe_17852

Standard Name

None

Aliases

None

Description

DJ-1_PfpI domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006006503.532628572200807e-24Lycopene biosynthesis-enhancin
g protein; similar to sigma cr
oss-reacting protein 27A
Oxytricha TrifallaxContig18437.0.g280.000000000005109089028063325DJ-1/PfpI family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17852(Protein)
MLAALSRKFGIAKKAAILLSGCGVYDGSEIHESVSIIMHLSRAGIQYQCFSINRSVPAVN
HASGTPAEGLRNMLEESARIARGDVKSISEMKPEAYDALFIPGGFGIAKNFSNFASAGDK
MEVDPEVAKAVWEFFHAKKPIGACCIAPVILAKIFGTVSGKSGLDVTLGKKGAEWPYAGS
IEVANKFGNKLVDCDIDDICKDRFNNVVTTPAYMRETAKPHEVFDGIKKMVDEVISYI


>SteCoe_17852(CDS)
ATGCTCGCAGCCCTATCGAGGAAATTCGGTATAGCCAAGAAAGCAGCGATTTTACTTTCT
GGCTGTGGAGTTTATGATGGTTCAGAAATACATGAAAGTGTATCAATCATCATGCATTTA
TCAAGAGCTGGAATACAATACCAGTGTTTTTCCATAAATCGTAGTGTCCCTGCTGTAAAC
CATGCTAGTGGCACACCAGCAGAAGGGCTTAGAAATATGCTTGAAGAAAGCGCTAGAATA
GCAAGAGGTGATGTTAAATCTATTTCTGAAATGAAACCAGAAGCATATGACGCACTTTTT
ATTCCTGGGGGTTTTGGTATTGCAAAAAACTTTAGCAACTTTGCTAGCGCAGGAGATAAA
ATGGAAGTAGATCCTGAAGTAGCCAAGGCTGTTTGGGAATTCTTTCATGCTAAAAAGCCA
ATTGGTGCATGTTGTATTGCTCCTGTTATATTAGCAAAGATTTTTGGGACTGTTTCAGGC
AAGTCAGGTCTTGATGTAACCCTTGGAAAGAAAGGAGCAGAATGGCCTTATGCTGGGAGT
ATTGAAGTGGCAAATAAATTTGGGAATAAATTAGTTGACTGTGATATTGATGATATATGC
AAGGATAGGTTTAATAATGTTGTGACAACCCCTGCATATATGAGGGAGACAGCAAAGCCA
CATGAAGTATTTGATGGAATTAAGAAAATGGTAGATGAAGTAATTAGTTATATTTAG