Identifiers and Description

Gene Model Identifier

SteCoe_17992

Standard Name

None

Aliases

None

Description

PUF domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14151.0.g553.6251409191435593e-34Pumilio-family RNA binding rep
eat

WormBaseWBGene000042453.975449735908647e-31
Tetrahymena ThermophilaTTHERM_005584901.185064864233981e-27Pumilio-family RNA binding rep
eat containing protein
Saccharomyces CerevisiaeYLL013C1.7587922024243116e-25Protein of the mitochondrial o
uter surface; links the Arp2/3
complex with the mitochore du
ring anterograde mitochondrial
movement; also binds to and p
romotes degradation of mRNAs f
or select nuclear-encoded mito
chondrial proteins

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_17992(Protein)
MLEKKLIGNILNEGDDSDEEMLTRYVKTKRCVLFNYDELNKLPGRPISAPVDFVPFSAGN
TVKSPKESHEETKIPPPEIKVQGNFNTSAPEFVPSFKPPIFESKNSAVLSLRGRISELAR
DQSGSRFLQQQYEVATPDEKQMIFEEILTNCLPLIVDVFGNYVVQKLFDYGTKEHKRAVA
LQMLGKIVDLSLHTYGCRVLQKVLETVEFDQKRMICQEFYGNVEKAVEDQNGNHVVQKCL
EILPYNCTSFIVDSVKYNTVYWAKHQYGCRVIQKIIEFCPRDQMNLVFDEIIQNSIEISK
ENYGNYVIQHILDKGHPQDRERIVNSYKGRLIELSRHKFASNVIEKCFVVGSPSQINDFS
IEIFESPQVVDLMTDKFGNFVIQKALEKSTGKLQSFLINKVNEKAHIIRNYNFGKHVLNC
LEKLRKYNPR


>SteCoe_17992(CDS)
ATGCTTGAAAAGAAACTAATAGGGAACATCTTAAATGAAGGTGATGACTCTGATGAAGAG
ATGCTTACAAGGTATGTAAAAACTAAAAGGTGCGTTTTATTCAATTACGACGAGCTAAAT
AAGCTACCTGGCAGACCAATCTCAGCTCCAGTCGATTTTGTCCCTTTTTCAGCAGGAAAC
ACTGTGAAAAGCCCTAAAGAGTCTCATGAAGAAACAAAAATCCCTCCACCTGAAATCAAA
GTTCAAGGCAATTTCAACACGAGTGCGCCAGAATTTGTCCCAAGCTTTAAACCACCTATT
TTCGAAAGTAAAAACTCAGCTGTTCTTTCACTTAGAGGAAGGATTTCAGAGCTTGCTAGA
GATCAAAGTGGGTCAAGGTTTTTACAGCAGCAATATGAAGTTGCAACACCTGATGAAAAG
CAAATGATTTTTGAAGAAATTCTGACGAATTGCCTTCCGCTTATTGTTGATGTTTTTGGG
AATTATGTTGTCCAGAAACTTTTTGATTATGGGACGAAGGAACATAAACGTGCTGTAGCT
TTGCAGATGCTTGGGAAAATTGTTGATTTATCTTTACATACATATGGATGTAGGGTGTTG
CAAAAAGTTCTAGAAACGGTTGAGTTTGACCAGAAAAGAATGATTTGCCAAGAGTTTTAT
GGAAATGTAGAAAAAGCTGTTGAAGATCAAAATGGGAACCACGTGGTTCAGAAATGCTTA
GAAATCCTCCCTTATAATTGTACAAGTTTTATTGTGGACTCAGTTAAATATAATACTGTC
TATTGGGCAAAACATCAATATGGATGTAGGGTTATACAGAAGATCATTGAGTTTTGCCCA
AGAGATCAAATGAATTTAGTTTTTGATGAAATTATCCAAAATTCAATTGAAATTAGTAAA
GAAAACTATGGAAATTATGTTATACAACATATTCTAGATAAAGGACATCCTCAAGATAGA
GAAAGAATTGTTAATAGCTATAAAGGAAGACTTATTGAACTGAGTAGACACAAATTCGCT
AGTAATGTGATTGAAAAATGCTTTGTTGTTGGTAGTCCGAGCCAAATAAATGATTTCTCT
ATTGAAATCTTTGAATCACCTCAAGTAGTTGATCTTATGACAGACAAGTTTGGAAATTTC
GTTATACAAAAAGCTCTTGAAAAGTCAACTGGTAAACTCCAAAGCTTTTTGATAAACAAA
GTTAACGAAAAAGCGCATATTATTAGAAACTATAATTTCGGTAAGCATGTTCTGAATTGC
TTGGAAAAACTCAGAAAGTATAATCCTAGGTAA